NovoPro
Cart 2

Product Name

Molecular Formula

Sequence

C63H105N19O17

TLSRVPSLPQRF

C55H84N14O18

PVPDSSFLRDP

C60H93N17O18S

SLNTKNDFMRF

C44H68N12O9S2

GGKMFMRF

C47H71N13O12

AKDNFLRF

C43H60N10O14S

EEDFMRF

C49H71N11O12

KPPFNGSIF

C64H92N14O15

YKKPPFNGSIF

C68H99N15O17

TYKKPPFNGSIF

C55H83N13O13

KKPPFNGSIF

C140H207N35O45S2

AGGDSLYEPGKALASACQVAVEACAAWFPGPE

C50H82N18O15

GRGGPSNYVRL

C46H75N13O15

ADYLQLTRA

C45H67N13O9

QWLKGRF

C36H59N11O9

QLLGGRF

C46H74N12O13

GPETAFLRL

C49H74N16O14

GRSDNFIRF

C50H76N14O14

GKTDNFIRF

C91H142N28O39

SGPSYDEKEQENEDGNSVRL

C53H80N16O15

GGKQDNFIRF

C53H95N21O19

SGNSNELRRGKL

C86H141N27O24S

RALDQNLLVDEHLMRF

C55H83N19O17

GGRSNDNFIRF

C101H157N31O41

GHDFDQDDVNSSGEKDESLVRI

C52H78N16O15

GGKNDNFIRF

C53H80N18O14

GRPSNNFVRF

C64H104N22O22

SENPSNSRNFIRL

C45H75N15O13

TDRNFIRL

C52H80N16O15

GGKSGSNFIRF

C50H83N17O23

RDEEVTQREE

C58H101N25O15S

RRCSNRNFVRL

C51H85N17O14

ARPSSNFIRL

C103H162N28O48

DDSSNVETFDTEEEATTDSTLRV

C42H61N13O12

GNSNFVRF

C52H78N16O13

ARPDNFIRF

C47H71N13O12

GKQDFIRF

C49H74N14O14

GKSDNFIRF

C61H97N17O24

QTEDDDKFVRLS

C47H73N13O18

AEEQNQPPPV

C57H96N20O15

DGRTPALRLRF