NovoPro
Cart 2

Product Name

Molecular Formula

Sequence

C49H57N9O10

Nap-GFFKEH

C50H74N18O15

H-RNAENFDRF-Amidation

C115H185N43O29

H-YGRKKRRQRRRYKEGYNVYG-OH

C81H104N20O33

Acetylation-DDSDVWWGGADTDYADG-Amidation

C234H372N60O76S4

H-DKEMAATSAAIEDAVRRIEDMMNQYPYDVPDYAMDFSGLSLIKLKKQ-OH

C238H367N79O75S

H-MPVLPGTQRYPHQRRRFQAAGGGAESGKRGSEEAPGVAWSGSESGRDAATPAW-OH

C159H261N55O40

H-YGRKKRRQRRRFGRDEAPEPTQFPIPVKI-OH

C141H242N52O37S

H-YGRKKRRQRRRPDGVLAEALAMFRKTE-OH

C80H113N25O27

GNWDYNSQRAQLYNQ

C28H47N9O5S2

AMMRF-NH2, AVFRM-NH2, SVFRL-NH2

C188H300N62O34

RRIRFRPPYLPRPGRRPRFPPPFPIPRIPRIP

C65H112N20O19S2

QKISRCQVCVKYS

C83H114N18O23S2

Ac-LPSDDLEFWCHVMY-NH2

C81H130N30O19S1

RSMRLSFRARGYGFR (all D-type amino acids)

C89H147N29O25

SPLERNAIKGYRYLSTR-NH2

C105H177N29O35S1

GSGSGSTYLCGAISLAPKAQIKESL

C72H142N44O16

VSRRRRRRGGRRRR

C104H150N29O31

TFFYGGSRGKRNNFKTEEY

C24H34N8O8S

c(RGDyC)

C27H41N9O8

c(RGDyK)

C27H41N9O7

c(RGDfK)

C114H180N30O29S

GIGKFLHSAKKFGKAFVGEIMNS

C139H225N41O33

XRQNTRYSRIEWIKIQIISKLRL-amide (X = 2-naphthoxyacetyl group)

C104H171N37O22

Gu-ONNRPVYIPRPRPPHPRL-OH (Gu = N,N,N’,N’-tetramethylGuanidino and O = L-ornithine)

C26H38N8O7

c(RGDfV)

C34H54N8O9

H-LSFGSLP-NH2

C44H64N8O9

H-LPPYLFT-NH2

C228H388N86O64

H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH

C144H234N44O47

TRSAWPSTAASGLLEDPLPHTSRTSLEPSLR

C55H85N11O20

DLDSVLDPSIF

C77H113N23O24

SPALADEHNDNFLRF

C49H82N18O16

GRGASSNYVRL

C46H75N13O16

SDYLQLART

C43H70N12O14

GVDSSFVRL

C46H77N15O13

ADYLRLARA

C49H72N12O13

GPETAFFRL

C37H61N11O10

AQSFVRL

C50H76N14O18

PASDSGFLRDP

C73H114N22O26

SPVPEDDRGDNFVRL

C42H68N12O13

ADYLQLAR