New Articles List

Cis-regulatory elements and trans-regulatory elements are two types of DNA segments that have distinct functions in gene regulation. Cis-regulatory elements are located on the same DNA molecule as the gene they regulate. They are typically short DNA...

A series of diseases characterized by pathological changes in tau proteins, including Alzheimer's disease (AD), are classified as tauopathies (tauopathies). Their common feature is the presence of intracellular neurofibrillary tangles (NFTs) made...

Terrific Broth (TB)12 g/L tryptone (1.2% m/V)24 g/L yeast extract (2.4% m/V)4 mL/L glycerol (4.34 mM, 0.4% V/V)17 mM KH2PO4, 2.31 g/L72 mM K2HPO4, 12.54 g/L(opt.) 15 g/L agar (1.5% m/V)(opt., nontrad.) 5–10 mM 1 M MgSO4  or MgCl2The original sug...

mScarlet3 is a type of red fluorescent protein that has been developed by researchers to label specific structures and organelles in cells. It is a monomeric protein, which means that it exists as a single molecule rather than forming aggregates. The...

For producing lentiviral particles you typically need three components: 1) a lentiviral vector, such as pLKO.1 or pLVTHM or pLVX-PURO, containing the shRNA or transgene, 2) a packaging vector, such as psPAX2 or pCMV-dR8.2 dvpr and 3) an envelop vecto...

INCI Name Sequence CAS Molecular Formula Tripeptide-10 Citrulline H-Lys-Asp-Ile-Cit-NH2 960531-53-7 C22H42N8O7 Palmitoyl Tripeptide-5 palmitoyl-Lys-Val-Lys-OH 623172-56-5 C33H65N5O5 Acetyl Tetrapeptide-11 Ac-Pro-Pro-Tyr-Leu-OH 928006-88-6 C27H38N4O7...

(1) CyclizationHead-to-tail cyclic, stapled peptide, side chain cyclic, multiple disulfide-bonds cyclic (Sec&Sec), monothioether cyclic, click chemistry, Cyclization via xylene or mesitylene(2) Isotopic labeling13C, 15N modified R or K (D type or...

Cyclisation Cyclisation techniques have been used widely in the peptide field and achieved in several ways from cyclising head to tail, head/tail to side chain or side chain to side chain. A type of side chain to side chain cyclisation is called sta...

Human elongation factor-1 alpha (EF-1 alpha) is a constitutive promoter of human origin that can be used to drive ectopic gene expression in various in vitro and in vivo contexts. EF-1 alpha is often useful in conditions where other promoters (such a...

>Mouse IgG1 (P01868-1) AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQ...