Px-cec1 peptide

Px-cec1 peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

H-KPFKKLEKVGRNIRDGIIKAGPAVAVIGQATSIARPTGK-OH

H-Lys-Pro-Phe-Lys-Lys-Leu-Glu-Lys-Val-Gly-Arg-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Ile-Gly-Gln-Ala-Thr-Ser-Ile-Ala-Arg-Pro-Thr-Gly-Lys-OH

39

95.15%

C₁₈₃H₃₁₈N₅₆O₄₉

4086.81

Synthetic

Powder

Px-cec1 is a cationic antibacterial peptide found in the diamondback moth, Plutella xylostella. It is encoded by a 480 bp full-length cDNA and is predominantly expressed in fat bodies, hemocytes, midgut, and epidermis, with the highest expression level in fat bodies.
Px-cec1 peptide exhibits a broad spectrum of antimicrobial properties against fungi, Gram-positive and Gram-negative bacteria, and does not exhibit hemolytic activity against human erythrocytes. The antibacterial activity of Px-cec1 is attributed to its ability to disrupt bacterial cell structures by acting on the cell membrane.
The recombinant Px-cec1 contains mainly alpha-helices and is stable over a wide range of pH values. It shows high activity against both Gram-negative and Gram-positive bacteria, as well as some fungi that can infect humans. The recombinant Px-cec1 can be produced using a thioredoxin fusion expression system in E. coli and purified using single-step affinity chromchromatography. The N-terminal two residues were altered to MA in the recombinant form.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Jin F, Sun Q, Xu X, et al. cDNA cloning and characterization of the antibacterial peptide cecropin 1 from the diamondback moth, Plutella xylostella L. Protein Expr Purif. 2012;85(2):230-8.
• Ouyang L, Xu X, Freed S, Gao Y, Yu J, Wang S, Ju W, Zhang Y, Jin F. Cecropins from Plutella xylostella and Their Interaction with Metarhizium anisopliae. PLoS One. 2015 Nov 6;10(11):e0142451.

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.