Natriuretic peptide PaNP-d

Natriuretic peptide PaNP-d

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

SGSKTAEIDDGCFGLPLDPIGSTSGMGCRSVPKPIPGGS

Ser-Gly-Ser-Lys-Thr-Ala-Glu-Ile-Asp-Asp-Gly-Cys-Phe-Gly-Leu-Pro-Leu-Asp-Pro-Ile-Gly-Ser-Thr-Ser-Gly-Met-Gly-Cys-Arg-Ser-Val-Pro-Lys-Pro-Ile-Pro-Gly-Gly-Ser

39

95.14%

C₁₆₀H₂₆₀N₄₄O₅₆S₃

3792.21

Synthetic

Powder

Natriuretic peptide PtNP-d is a natriuretic peptide that has been isolated from the venom of the Australian elapid snake, Pseudechis australis. It is one of the isoforms of natriuretic peptides found in these snakes.
The natriuretic peptides from Australian snakes, including PaNP-d, have conserved amino acid residues that are important for binding and stimulation of the natriuretic peptide receptor.
It is worth noting that the activity of PaNP-d may be influenced by variations in its amino acid composition.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• St pierre L, Flight S, Masci PP, et al. Cloning and characterisation of natriuretic peptides from the venom glands of Australian elapids. Biochimie. 2006;88(12):1923-31.

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.