catalog peptide: FOXO4 D-Retro-Inverso(DRI) peptide

FOXO4 D-Retro-Inverso(DRI) peptide

Cat.#: 318716

Special Price 549.0 USD

Availability: In Stock

- +

Add to cart to get an online quotation

FOXO4 D-Retro-Inverso(DRI) peptide
MS/HPLC Reports

Possibly batch to batch variation of the purity

Quantity/Unit 1 Vial
Three letter code H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH
Length 46
Peptide Purity (%) 95.2%
Molecular Formula C228H388N86O64
Molecular Weight 5358.05
Source Synthetic
Additional Information FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al. FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
Storage Guidelines Ideally FOXO4 D-Retro-Inverso(DRI) peptide should be stored in a freezer at or below -9C. FOXO4 D-Retro-Inverso(DRI) peptide should be refrigerated after reconstitution. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides
Terms Please do not use the peptide for human consumption. NovoPro will immediately deny any order that we feel will be used outside of the scope of its intended purpose.

Baar, Marjolein P. et al. Targeted Apoptosis Of Senescent Cells Restores Tissue Homeostasis In Response To Chemotoxicity And Aging. Cell 169.1 (2017): 132-147.e16. Web. 25 Mar. 2017.

Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.

Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.

Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.