NovoPro
Cart 2
  • FOXO4 D-Retro-Inverso(DRI) peptide

FOXO4 D-Retro-Inverso(DRI) peptide

Cat.#: 318716

Size:

Special Price 549.0 USD

Availability: In Stock
- +

Add to cart to get an online quotation

Product Information

  • Product Name
    FOXO4 D-Retro-Inverso(DRI) peptide
  • Documents

    Possibly batch to batch variation of the purity

  • Quantity/Unit
    1 Vial
  • Sequence
    H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
  • Three letter code
    H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH
  • Length (aa)
    46
  • Peptide Purity (HPLC)
    95.2%
  • Molecular Formula
    C228H388N86O64
  • Molecular Weight
    5358.05
  • Source
    Synthetic
  • Additional Information

    Note: the Net Peptide Content(NPC) of current batch is 69.92%. Click to view more

    FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al. FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
  • Storage Guidelines
    Ideally FOXO4 D-Retro-Inverso(DRI) peptide should be stored in a freezer at or below -9C. FOXO4 D-Retro-Inverso(DRI) peptide should be refrigerated after reconstitution. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides
  • References
    • Baar, Marjolein P. et al. Targeted Apoptosis Of Senescent Cells Restores Tissue Homeostasis In Response To Chemotoxicity And Aging. Cell 169.1 (2017): 132-147.e16. Web. 25 Mar. 2017.

Peptide Property

  • Analysed Sequence:H-(dL)(dT)(dL)(dR)(dK)(dE)(dP)(dA)(dS)(dE)(dI)(dA)(dQ)(dS)(dI)(dL)(dE)(dA)(dY)(dS)(dQ)(dN)(dG)(dW)(dA)(dN)(dR)(dR)(dS)(dG)(dG)(dK)(dR)(dP)(dP)(dP)(dR)(dR)(dR)(dQ)(dR)(dR)(dK)(dK)(dR)(dG)-OH
  • Chemical Formula:C228H388N86O64
  • Sequence length:46
  • Extinction coefficient:0 M-1cm-1
  • GRAVY:-1.63
  • Mw average:5358.03
  • Theoretical pI:12.41
  • Data Source:Peptide Property Calculator

GRAVY = grand average of hydropathy

Red: Hydrophobic uncharged residues, like F I L M V W A and P

Blue: Basic residues, like R K H and N-terminal -NH2

Green: Acidic residues, like D E and C-terminal -COOH

Black: Polar uncharged residues, like G S T C N Q and Y

Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.

Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.

Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"