Exendin 4 (5-39) peptide

Exendin 4 (5-39) peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

35

97.8%

C₁₇₆H₂₇₁N₄₆O₅₈S₁

3991.5

Synthetic

Powder

Exendin-4 (5-39) is an antagonist of glucagon-like peptide 1 (GLP-1) receptors. GLP-1 is a G protein-coupled receptor (GPCR) that shares sequence identity with other Family B receptors such as those for secretin, glucagon, and vasoactive intestinal peptide. Unlike the full length exendin-4, a GLP-1 agonist, exendin (5-39) antagonizes GLP-1 stimulated insulin release after food intake. Exendin (5-39) also modulates synaptic transmission via glutamate uptake in the dentate gyrus and improves memory impairment in β-amyloid protein-treated rats.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.