Cytolysin (discontinued) peptide

Cytolysin (discontinued) peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

TTPACFTIGLGVGALFSAKFC

Thr-Thr-Pro-Ala-Cys-Phe-Thr-Ile-Gly-Leu-Gly-Val-Gly-Ala-Leu-Phe-Ser-Ala-Lys-Phe-Cys

21

95.8%

Synthetic

Powder

Enterococcus faecalis senses target cells and in response expresses cytolysin. The cytolysin consists of two structural subunits, CylLL and CylLS, that are activated by an extracellular protease, CylA. In the absence of target cells, the other subunit (CylL(L)'') forms a complex with CylL(S)'', blocking it from autoinducing the operon. When target cells are present, however, CylL(L)'' binds preferentially to the target, allowing free CylL(S)'' to accumulate above the induction threshold to express high levels of cytolysin (Coburn PS et al., 2004). The two chains work synergistically at a ratio of 1:1. CylLS contains two thioether bonds: T1-C5 and S17-C20. In addition, T2 and T7 are dehydrated. The AMINO ACID sequence of CylLL is TTPVCAVAATAAASSAACGWVGGGIFTGVTVWSLKHC. There are three thioether bonds: T1-C5, S14-C18, S34-C38. In addition, T2, T10, S15, and T30 are dehydrated. The peptide may also contain usual lanthionine stereochemistry (Tang and van der Donk, 2013 Nature Chem Biol ). Updated 1/2013; 9/2014. Cytolysin has Antimicrobial activity. The source of Cytolysin is Enterococcus faecalis.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Booth MC, Bogie CP, Sahl HG, Siezen RJ, Hatter KL, Gilmore MS. Structural analysis and proteolytic activation of Enterococcus faecalis cytolysin, a novel lantibiotic. Mol Microbiol. 1996;21(6):1175-1184. doi:10.1046/j.1365-2958.1996.831449.x

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.