Cecropin B peptide

Cecropin B peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2

H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2

35

95.62%

C₁₇₆H₃₀₂N₅₂O₄₁S

3834.65

Synthetic

Powder

Cecropin B is a natural linear cationic α-helical antimicrobial peptide (AMP) originally identified in insects. Cecropin B has a wide spectrum of antimicrobial activities against gram-negative bacteria, gram-positive bacteria, and fungal phytopathogens, killing bacteria by affecting the integrity of the bacterial membranes. Cecropins constitute a main part of the innate immune system of insects.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Kulagina et al (2007) Antimicrobial peptides as new recognition molecules for screening challenging species. Sens. Actuators B Chem. 121(1) 150 PMID: 18231571
• Hu et al (2013) Broad activity against porcine bacterial pathogens displayed by two insect antimicrobial peptides moricin and cecropin B. Mol. Cells 35(2) 106 PMID: 23456332
• Yu et al (2016) Combination Effects of Antimicrobial Peptides. Antimicrob. Agents and Chemother. 60 (3) 1717 PMID: 26729502

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.