Amylin peptide

Amylin peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

H-KCNTATCVTQRLADFLVRSSNTRGTVYAPTNVGANTY-OH

H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-Gln-Arg-Leu-Ala-Asp-Phe-Leu-Val-Arg-Ser-Ser-Asn-Thr-Arg-Gly-Thr-Val-Tyr-Ala-Pro-Thr-Asn-Val-Gly-Ala-Asn-Thr-Tyr-OH

37

95.5%

C₁₆₉H₂₇₄N₅₂O₅₆S₂

3994.41

Synthetic

Powder

The source of Amylin is foldfish takifugu (Carassius auratus). Goldfish Amylin is a conserved peptide showing the typical structure characteristics present in their mammalian counterparts.
Amylin mRNA is mostly expressed in the brain, in particular posterior brain, optic tectum and hypothalamus, but is also present in pituitary, gonad, kidney and muscle. Amylin mRNA distribution suggests possible new roles for this peptide in teleosts, including the control of reproduction.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Martínez-alvarez RM, Volkoff H, Cueto JA, Delgado MJ. Molecular characterization of calcitonin gene-related peptide (CGRP) related peptides (CGRP, amylin, adrenomedullin and adrenomedullin-2/intermedin) in goldfish (Carassius auratus): cloning and distribution. Peptides. 2008;29(9):1534-43.

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.