ALL-38 peptide

ALL-38 peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

ALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Ala-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser

38

97.3%

Synthetic

Powder

One gene, two cathelicidin peptides (LL-37 and ALL-38). Compared to LL-37, ALL-38 contains one additional residue (Ala) at the N-terminus. ALL-38 is produced in female vagina under an acidic condition by cleaving the precursor protein hCAP-18 from male semen, presumably providing a sterilized environment for the new life (see the APD entry 00005 for a similar compd in insects). The antimicrobial activities of LL-37 and ALL-38 are similar against bacterial strains (E. coli, P. aeruginosa, S. aureus, and B. megaterium). We predict that the 3D structure and mechanism of action of ALL-38 are very similar, if not identical, to human LL-37 (see APD entry 310). ALL-38 has Antibacterial activity. The source of ALL-38 is sperm, Homo sapiens.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.