• Adropin (34-76) (human, mouse, rat) peptide

Adropin (34-76) (human, mouse, rat) peptide

Not For Human Use, Lab Use Only.

Cat.#: 314322

Size:

* Buy 1 get 1 free (?)

Special Price 644.60 USD

Availability: In Stock
- +

Add to cart to get an online quotation

Product Information

  • Product Name
    Adropin (34-76) (human, mouse, rat) peptide
  • Documents
  • Sequence Shortening
    CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
  • Sequence
    H-Cys-His-Ser-Arg-Ser-Ala-Asp-Val-Asp-Ser-Leu-Ser-Glu-Ser-Ser-Pro-Asn-Ser-Ser-Pro-Gly-Pro-Cys-Pro-Glu-Lys-Ala-Pro-Pro-Pro-Gln-Lys-Pro-Ser-His-Glu-Gly-Ser-Tyr-Leu-Leu-Gln-Pro-OH Trifluoroacetate, Disulfide Bridge: 1-23
  • Length (aa)
    43
  • Peptide Purity (HPLC)
    96.09%
  • Molecular Formula
    C190H293N55O68S2
  • Molecular Weight
    4499.77
  • CAS No.
    1802086-30-1
  • Source
    Synthetic
  • Form
    Powder
  • Description

    Adropin (34-76) (human, mouse, rat) is a peptide hormone derived from the putative secreted domain of adropin, which plays a significant role in regulating metabolic homeostasis. This peptide is abundantly expressed in the brain and liver, and it has been shown to influence hepatic glucose metabolism by modulating key intracellular signaling pathways. Adropin (34-76) enhances insulin-mediated signaling activities in the liver, including the phosphorylation of IRS1 and AKT, which subsequently suppresses glucose production and promotes glycogen synthesis.

    In addition to its effects on insulin signaling, Adropin (34-76) alleviates endoplasmic reticulum (ER) stress responses and reduces the activity of c-Jun N-terminal kinase (JNK) in the liver. It also suppresses cAMP-activated protein kinase A (PKA) activities, leading to decreased phosphorylation of inositol trisphosphate receptor (IP3R) and cAMP-responsive element-binding protein (CREB). These molecular mechanisms collectively contribute to the peptide's ability to regulate hepatic glucose metabolism and maintain metabolic balance.

  • Storage Guidelines
    Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides
  • References
    • Kumar, K. G., Trevaskis, J. L., Lam, D. D., Sutton, G. M., Koza, R. A., Chouljenko, V. N., Kousoulas, K. G., Rogers, P. M., Kesterson, R. A., Thearle, M., Ferrante, A. W., Jr, Mynatt, R. L., Burris, T. P., Dong, J. Z., Halem, H. A., Culler, M. D., Heisler, L. K., Stephens, J. M., & Butler, A. A. (2008). Identification of adropin as a secreted factor linking dietary macronutrient intake with energy homeostasis and lipid metabolism. Cell metabolism, 8(6), 468–481. https://doi.org/10.1016/j.cmet.2008.10.011
    • Gao, S., Ghoshal, S., Zhang, L., Stevens, J. R., McCommis, K. S., Finck, B. N., Lopaschuk, G. D., & Butler, A. A. (2019). The peptide hormone adropin regulates signal transduction pathways controlling hepatic glucose metabolism in a mouse model of diet-induced obesity. The Journal of biological chemistry, 294(36), 13366–13377. https://doi.org/10.1074/jbc.RA119.008967
  • About TFA salt

    Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

    Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

    Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

    In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.

  • Molar Concentration Calculator

  • Dilution Calculator

  • Percent Concentration Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight

Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.

Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.

Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"