pSH016 vector (V003258)

LOCUS       V003258                10886 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V003258
VERSION     V003258
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 10886)
  AUTHORS   Lo J, Zheng T, Hon S, Olson DG, Lynd LR.
  TITLE     The bifunctional alcohol and aldehyde dehydrogenase gene, adhE, is
            necessary for ethanol production in Clostridium thermocellum and
            Thermoanaerobacterium saccharolyticum
  JOURNAL   J. Bacteriol. 197 (8), 1386-1393 (2015)
   PUBMED   25666131
REFERENCE   2  (bases 1 to 10886)
  AUTHORS   Zheng T, Olson DG, Tian L, Bomble YJ, Himmel ME, Lo J, Hon S, Shaw
            AJ, van Dijken JP, Lynd LR.
  TITLE     Cofactor Specificity of the Bifunctional Alcohol and Aldehyde
            Dehydrogenase (AdhE) in Wild-Type and Mutant Clostridium
            thermocellum and Thermoanaerobacterium saccharolyticum
  JOURNAL   J. Bacteriol. 197 (15), 2610-2619 (2015)
   PUBMED   26013492
REFERENCE   3  (bases 1 to 10886)
  AUTHORS   Hon S.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-DEC-2014) Thayer School of Engineering, Dartmouth
            College, 14 Engineering Drive, Hanover, NH 03755, USA
REFERENCE   4  (bases 1 to 10886)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 10886)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J.
            Bacteriol."; date: "2015"; volume: "197"; issue: "8"; pages:
            "1386-1393"
            SGRef: number: 2; type: "Journal Article"; journalName: "J.
            Bacteriol."; date: "2015"; volume: "197"; issue: "15"; pages:
            "2610-2619"
            SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
            (05-DEC-2014) Thayer School of Engineering, Dartmouth College, 14
            Engineering Drive, Hanover, NH 03755, USA"
            SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10886
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(561..1418)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(1419..1523)
                     /label="AmpR promoter"
     misc_feature    1613..2112
                     /label="5' homology flank #1"
                     /note="5' homology flank #1"
     CDS             2691..3338
                     /gene="cat"
                     /label="Chloramphenicol acetyltransferase"
                     /note="Chloramphenicol acetyltransferase from
                     Staphylococcus aureus. Accession#: P00485"
     CDS             3359..3904
                     /codon_start=1
                     /gene="hpt"
                     /product="hpt"
                     /label="hpt"
                     /note="hypoxanthine phosphoribosyltransferase"
                     /protein_id="AJO16031.1"
                     /translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK
                     GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII
                     DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD
                     EKYRNLPFIGVLKPEMYS"
     gene            3359..3904
                     /gene="hpt"
                     /label="hpt"
     misc_feature    4090..4589
                     /label="5' homology flank #2"
                     /note="5' homology flank #2"
     misc_feature    6952..7451
                     /label="3' homology flank"
                     /note="3' homology flank"
     terminator      7484..7672
                     /label="CYC1 terminator"
                     /note="transcription terminator for CYC1"
     rep_origin      complement(7932..8520)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(8607..9185)
                     /codon_start=1
                     /gene="tdk"
                     /product="Tdk"
                     /label="tdk"
                     /note="thymidine kinase"
                     /protein_id="AJO16032.1"
                     /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA
                     IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI
                     ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP
                     ANYDDPIIMVGAKESYEARCRKCHEVPRT"
     gene            complement(8607..9185)
                     /gene="tdk"
                     /label="tdk"
     CDS             complement(9885..10886)
                     /label="repB"
                     /note="RepB replication protein"