pSCUDMFE6L2 vector (V003403)

LOCUS       40924_39033        7589 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Yeast expression vector pSCUDMFE6L2, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7589)
  AUTHORS   De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman 
            Fonseca M, Vanhoucke M, Beyaert R.
  TITLE     BCCM/LMBP Plasmid collection
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7589)
  AUTHORS   De Schamphelaire W.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, 
            Technologiepark 927, 9052, BELGIUM
REFERENCE   3  (bases 1 to 7589)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7589)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 
            9052, BELGIUM"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7589
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      27..1016
                     /label=CYC1 promoter
                     /note="CYC1 promoter"
                     /regulatory_class="promoter"
     CDS             1040..1600
                     /label=DHFR
                     /note="mouse dihydrofolate reductase"
     terminator      1712..1959
                     /label=CYC1 terminator
                     /note="transcription terminator for CYC1"
     promoter        1978..2389
                     /label=TEF1 promoter
                     /note="promoter for EF-1-alpha"
     CDS             2409..2789
                     /codon_start=1
                     /note="unnamed protein product; bleomycin"
                     /protein_id="SJL88495.1"
                     /translation="MTDQATPNLPSRDFDSTAAFYERLGFGIVFRDAGWMILQRGDLKL
                     EFFAHPGLDPLASWFSCCLRLDDLAEFYRQCKSVGIQETSSGYPRIHAPELQEWGGTMA
                     ALVDPDGTLLRLIQNELLAGIS"
     regulatory      2888..3158
                     /label=CYC1 terminator
                     /note="CYC1 terminator"
                     /regulatory_class="terminator"
     terminator      2908..3155
                     /gene="S. cerevisiae CYC1"
                     /label=CYC1 terminator
                     /note="transcription terminator for CYC1"
     rep_origin      complement(3182..3770)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(3944..4801)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(4802..4906)
                     /label=AmpR promoter
     terminator      complement(5024..5271)
                     /label=CYC1 terminator
                     /note="transcription terminator for CYC1"
     misc_feature    complement(5330..5479)
                     /label=3' UTR of mIghg2b
                     /note="3' UTR of mIghg2b"
     CDS             complement(5483..5800)
                     /label=mIg-kappa-CL
                     /note="Mouse immunoglobulin kappa light chain constant
                     region"
     CDS             complement(6125..6379)
                     /label=alpha-factor secretion signal
                     /note="N-terminal secretion signal from S. cerevisiae 
                     alpha-factor"
     promoter        complement(6441..6882)
                     /label=GAL1 promoter
                     /note="inducible promoter, regulated by Gal4"
     gap             6892..7192
                     /estimated_length=301
     misc_feature    7223..7561
                     /label=Ty1
                     /note="Ty1"