pSCGALCaMET15-2 vector (V003411)

LOCUS       40924_38993       10533 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Yeast expression vector pSCGALCaMET15-2, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10533)
  AUTHORS   De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman 
            Fonseca M, Vanhoucke M, Beyaert R.
  TITLE     BCCM/LMBP Plasmid collection
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10533)
  AUTHORS   De Schamphelaire W.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, 
            Technologiepark 927, 9052, BELGIUM
REFERENCE   3  (bases 1 to 10533)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 10533)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 
            9052, BELGIUM"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10533
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    142..282
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(696..1209)
                     /direction=LEFT
                     /label=M13 ori
                     /note="M13 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     1697..1713
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             complement(1980..3071)
                     /label=LEU2
                     /note="3-isopropylmalate dehydrogenase, required for
                     leucine biosynthesis"
     rep_origin      complement(3429..4775)
                     /direction=LEFT
                     /label=2u ori
                     /note="yeast 2u plasmid origin of replication"
     terminator      complement(4784..5031)
                     /label=CYC1 terminator
                     /note="transcription terminator for CYC1"
     misc_feature    complement(5135..5172)
                     /label=3UTR
                     /note="3UTR"
     CDS             complement(5173..6495)
                     /codon_start=1
                     /note="unnamed protein product; CaMET15"
                     /protein_id="SJL88109.1"
                     /translation="MPSHFDTLQLHAGQPVEKPHQPRAPPIYATTSYVFNDSKHGAQLF
                     GLETPGYIYSRIMNPTNDVFEQRIAALEGGIGALATSSGQSAQFLAIAGLAHAGDNIIS
                     TSYLYGGTYNQFKVAFKRLGIETKFVNGDAAEDFAKLIDDKTKAIYIETIGNPKYNVPD
                     FEKITKLAHEHGIPVVVDNTFGAGGFLVNPIAHGADIVVHSATKWIGGHGTTIAGVIVD
                     SGNFPWTEYPEKYPQFSKPSEGYHGLILNDALGKAAYIGHLRIELLRDLGPALNPFGSF
                     LLLQGLETLSLRVERQSENALKLAQWLEKNPNVESVSYLGLPSHESHELSKKYLNNDAK
                     YFGGALAFTVKDITNTSSDPFNEASPKLVDNLEIASNLANVGDSKTLVIAPWFTTHQQL
                     SDEEKLASGVTKGLIRVSTGTEYIDDIINDFEQAFKKVYNN"
     misc_feature    complement(6496..6511)
                     /label=5UTR
                     /note="5UTR"
     protein_bind    6894..7011
                     /label=UAS
                     /note="upstream activating sequence mediating
                     Gal4-dependent induction"
     CDS             complement(7271..8071)
                     /label=URA3
                     /note="orotidine-5'-phosphate decarboxylase, required for
                     uracil biosynthesis"
     promoter        complement(8072..8288)
                     /label=URA3 promoter
     primer_bind     complement(8308..8324)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    8332..8348
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(8356..8386)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(8401..8422)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(8710..9298)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(9471..10328)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(10329..10433)
                     /label=AmpR promoter