pSC189 vector (V003443)

LOCUS       40924_38843        6982 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Transposon delivery vector pSC189, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6982)
  AUTHORS   Chiang SL, Rubin EJ.
  TITLE     Construction of a mariner-based transposon for epitope-tagging and 
            genomic targeting
  JOURNAL   Gene 296 (1-2), 179-185 (2002)
  PUBMED    12383515
REFERENCE   2  (bases 1 to 6982)
  AUTHORS   Chiang SL, Rubin EJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-MAY-2002) Microbiology, Harvard Medical School, 200 
            Longwood Avenue, Armenise I-427, Boston, MA 02115, USA
REFERENCE   3  (bases 1 to 6982)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6982)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Gene 296 
            (1-2), 179-185 (2002)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (28-MAY-2002) Microbiology, Harvard Medical School, 200 Longwood 
            Avenue, Armenise I-427, Boston, MA 02115, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6982
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             171..1217
                     /codon_start=1
                     /product="mariner transposase C9 mutant"
                     /label=mariner transposase C9 mutant
                     /protein_id="AAM82289.1"
                     /translation="MEKKEFRVLIKYCFLKGKNTVEAKTWLDNEFPDSAPGKSTIIDWY
                     AKFKRGEMSTEDGERSGRPKEVVTDENIKKIHKMILNDRKMKLIEIAEALKISKERVGH
                     IIHQYLDMRKLCAKWVPRELTFDQKQRRVDDSKRCLQLLTRNTPEFFRRYVTMDETWLH
                     HYTPESNRQSAEWTATGEPSPKRGKTQKSAGKVMASVFWDAHGIIFIDYLEKGKTINSD
                     YYMALLERLKVEIAAKRPHMKKKKVLFHQDNAPCHKSLRTMAKIHELGFELLPHPPYSP
                     DLAPSDFFLFSDLKRMLAGKKFGCNEEVIAETEAYFEAKPKEYYQNGIKKLEGRYNRCI
                     ALEGNYVE"
     promoter        complement(1280..1298)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     protein_bind    1635..1656
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        1671..1701
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    1709..1725
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     1733..1749
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        1770..1788
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     repeat_region   1801..1827
     CDS             1843..1908
                     /label=3xFLAG
                     /note="three tandem FLAG(R) epitope tags, followed by an 
                     enterokinase cleavage site"
     protein_bind    1912..1959
                     /label=FRT
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     promoter        complement(1978..1996)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     rep_origin      2204..2592
                     /label=R6K gamma ori
                     /note="gamma replication origin from E. coli plasmid R6K;
                     requires the R6K initiator protein pi for replication"
     primer_bind     complement(2729..2745)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             3143..3934
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     protein_bind    3971..4018
                     /label=FRT
                     /bound_moiety="FLP recombinase from the Saccharomyces
                     cerevisiae 2u plasmid"
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     repeat_region   4032..4058
     promoter        complement(4071..4089)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(4096..4112)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             complement(4681..5049)
                     /label=traJ
                     /note="oriT-recognizing protein"
     oriT            complement(5082..5191)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"
     promoter        5861..5965
                     /label=AmpR promoter
     CDS             5966..6823
                     /label=AmpR
                     /note="beta-lactamase"