pTG8 vector (V002735)

LOCUS       40924_43148        3417 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pTG8, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3417)
  AUTHORS   Yang Y, Spector A.
  TITLE     Improved cloning vectors for transgene construction
  JOURNAL   BioTechniques 22 (6), 1032-1034 (1997)
  PUBMED    9187746
REFERENCE   2  (bases 1 to 3417)
  AUTHORS   Yang Y, Spector A.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAY-1999) Institute of Molecular Biology, University 
            of Hong Kong, 8 Sassoon, Pokfulam, Hong Kong
REFERENCE   3  (bases 1 to 3417)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3417)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "BioTechniques"; date: "1997"; volume: "22"; issue: "6"; pages: 
            "1032-1034"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (21-MAY-1999) Institute of Molecular Biology, University of Hong 
            Kong, 8 Sassoon, Pokfulam, Hong Kong"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3417
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(3..458)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     600..616
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        635..653
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     misc_feature    662..769
                     /label=MCS
                     /note="pBluescript multiple cloning site"
     promoter        complement(782..800)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(830..846)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(854..870)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(878..908)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(923..944)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(1232..1820)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(2316..2867)
                     /codon_start=1
                     /product="chloramphenicol acetyltransferase"
                     /label=chloramphenicol acetyltransferase
                     /protein_id="AAF61635.1"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPELRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPFSPWANIIRKATRC"
     promoter        complement(2868..2970)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     promoter        complement(3290..3394)
                     /label=AmpR promoter