Price Information
| Cat No. | Plasmid Name | Availability | Buy one, get one free! (?) |
|---|---|---|---|
| V002820 | pTac15K | In stock, instant shipping |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pTac15K
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3742 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Kim B, Binkley R, Kim HU, Lee SY.
- Promoter:
- tac
- Growth Temperature:
- 37℃
pTac15K vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Choi Y, Park TJ, Lee DC, Lee SY. Recombinant Escherichia coli as a biofactory for various single- and multi-element nanomaterials. Proc Natl Acad Sci U S A. 2018 Jun 5;115(23):5944-5949.
pTac15K vector Sequence
LOCUS 40924_42514 3742 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pTac15K, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3742)
AUTHORS Kim B, Binkley R, Kim HU, Lee SY.
TITLE Metabolic engineering of Escherichia coli for the enhanced
production of l-tyrosine
JOURNAL Biotechnol. Bioeng. (2018) In press
PUBMED 30019750
REFERENCE 2 (bases 1 to 3742)
AUTHORS Yang D, Kim WJ, Yoo SM, Choi JH, Ha SH, Lee MH, Lee SY.
TITLE Direct Submission
JOURNAL Submitted (15-JUN-2018) Dept. Chemical and Biomolecular Engineering,
Korea Advanced Institute of Science and Technology, Daehak-ro 291,
Daejeon 34141, South Korea
REFERENCE 3 (bases 1 to 3742)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 3742)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol.
Bioeng. (2018) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(15-JUN-2018) Dept. Chemical and Biomolecular Engineering, Korea
Advanced Institute of Science and Technology, Daehak-ro 291, Daejeon
34141, South Korea"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3742
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 3..59
/label=MCS
/note="pUC18/19 multiple cloning site"
terminator 262..348
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 440..467
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
promoter 487..578
/label=AmpR promoter
primer_bind complement(891..907)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
CDS 1150..1962
/codon_start=1
/label=KanR
/note="aminoglycoside phosphotransferase"
/translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
rep_origin 2494..3039
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
promoter 3676..3704
/label=tac promoter
/note="strong E. coli promoter; hybrid between the trp and
lac UV5 promoters"
protein_bind 3712..3728
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."