pSV51E6Hf1 vector (V002957)

LOCUS       V002957                 9472 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V002957
VERSION     V002957
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 9472)
  AUTHORS   De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman
            Fonseca M, Vanhoucke M, Beyaert R.
  TITLE     BCCM/LMBP Plasmid collection
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 9472)
  AUTHORS   De Schamphelaire W.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent,
            Technologiepark 927, 9052, BELGIUM
REFERENCE   3  (bases 1 to 9472)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 9472)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927,
            9052, BELGIUM"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9472
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        82..439
                     /label="SV40 promoter"
                     /note="SV40 enhancer and early promoter"
     CDS             453..974
                     /label="small t antigen"
                     /note="SV40 (simian virus 40) small t antigen"
     intron          979..1044
                     /label="small t intron"
                     /note="SV40 (simian virus 40) small t antigen intron"
     CDS             1174..1194
                     /label="SV40 NLS"
                     /note="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
     polyA_signal    2948..3082
                     /label="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     CDS             complement(3088..3810)
                     /codon_start=1
                     /note="unnamed protein product; mIghg2b; fragment of heavy
                     chain of mouse anti-hPLAP monoclonal antibody (E6H)"
                     /protein_id="SJL89001.1"
                     /translation="MEWIWIFLFILSGTAGVQSQVQLQQSGAELARPGASVKLSCKASG
                     YTLTSYGISWVKQRTGQGLEWIGEIYPGSGNSYFNEKFKGKATLTVDKSSSTAYLHLSS
                     LTSEDSAVYFCAGPRQVGLLPFGYWGQGTLVTASAAKTTPPSVYPLAPGCGDTTGSSVT
                     LGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCS
                     VAHPASSTTVDKKLEPSV"
     misc_feature    complement(3979..4916)
                     /label="intron"
                     /note="intron"
     CDS             complement(4923..5108)
                     /note="Agnoprotein from Simian virus 40. Accession#:
                     P03084"
                     /label="Agnoprotein"
     promoter        5180..5509
                     /label="SV40 promoter"
                     /note="SV40 enhancer and early promoter"
     CDS             5523..6044
                     /label="small t antigen"
                     /note="SV40 (simian virus 40) small t antigen"
     CDS             6244..6264
                     /label="SV40 NLS"
                     /note="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
     misc_feature    7319..7459
                     /label="bom"
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(7645..8233)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(8407..9264)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(9265..9369)
                     /label="AmpR promoter"