pSK485 vector (V003160)

LOCUS       40924_40557        7664 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pSK485, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7664)
  AUTHORS   Hartmann T, Dumig M, Jaber BM, Szewczyk E, Olbermann P, Morschhauser
            J, Krappmann S.
  TITLE     Validation of a Self-Excising Marker in the Human Pathogen 
            Aspergillus fumigatus by Employing the {beta}-Rec/six Site-Specific 
            Recombination System
  JOURNAL   Appl. Environ. Microbiol. 76 (18), 6313-6317 (2010)
  PUBMED    20656854
REFERENCE   2  (bases 1 to 7664)
  AUTHORS   Duemig M, Krappmann S.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JUL-2010) YIG3, Research Center for Infectious 
            Diseases, Josef-Scneider-Str. 2/D15, Wuerzburg 97080, Germany
REFERENCE   3  (bases 1 to 7664)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7664)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Appl. 
            Environ. Microbiol."; date: "2010"; volume: "76"; issue: "18"; 
            pages: "6313-6317"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (07-JUL-2010) YIG3, Research Center for Infectious Diseases, 
            Josef-Scneider-Str. 2/D15, Wuerzburg 97080, Germany"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7664
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     293..309
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        320..338
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     misc_recomb     389..478
                     /label=six site
                     /note="six site"
     regulatory      484..2171
                     /note="derived from Penicillium chrysogenum xylP; similar
                     to INSD accession M98458.2"
                     /regulatory_class="promoter"
     regulatory      2028..2032
                     /regulatory_class="CAAT_signal"
     regulatory      2095..2099
                     /regulatory_class="TATA_box"
     CDS             2177..2794
                     /codon_start=1
                     /gene="beta"
                     /product="beta-recombinase"
                     /label=beta
                     /note="beta-rec; codon optimized for expression in
                     Aspergillus fumigatus"
                     /protein_id="ADM43596.1"
                     /translation="MAKIGYARVSSKEQNLDRQLQALQGVSKVFSDKLSGQSVERPQLQ
                     AMLNYIREGDIVVVTELDRLGRNNKELTELMNAIQQKGATLEVLNLPSMNGIEDENLRR
                     LINNLVIELYKYQAESERKRIKERQAQGIEIAKSKGKFKGRQHKFKENDPRLKHAFDLF
                     LNGCSDKEVEEQTGINRRTFRRYRTRYNVTVDQRKNKGKRDS"
     gene            2177..2794
                     /gene="beta"
                     /label=beta
     terminator      3010..3573
                     /label=trpC terminator
                     /note="transcription terminator from the Aspergillus
                     nidulans trpC gene"
     gene            complement(3573..5560)
                     /label=ptrA
                     /note="useful as a dominant selectable marker in
                     Aspergillus"
     misc_recomb     5583..5672
                     /label=six site
                     /note="six site"
     rep_origin      complement(5917..6505)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(6679..7536)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(7537..7641)
                     /label=AmpR promoter