pORI198 vector (V004210)

MSDS

Basic Vector Information

Vector Name:: pORI198

Antibiotic Resistance:: Ampicillin

Length:: 6598 bp

Type:: Shuttle vector

Replication origin:: ori

Source/Author:: Papadimitriou K, Anastasiou R, Maistrou E, Plakas T, Papandreou NC, Hamodrakas SJ, Ferreira S, Supply P, Renault P, Pot B, Tsakalidou E.

pORI198 vector Vector Map

View Map in NovoBuilder

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pORI198 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       V004210                 6598 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004210
VERSION     V004210
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 6598)
  AUTHORS   Papadimitriou K, Anastasiou R, Maistrou E, Plakas T, Papandreou NC,
            Hamodrakas SJ, Ferreira S, Supply P, Renault P, Pot B, Tsakalidou E.
  TITLE     Analysis of the lactococcal plasmid pSMA198 found in Streptococcus
            macedonicus ACA-DC 198 supports the dairy origin of the species
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 6598)
  AUTHORS   Papadimitriou K.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-APR-2014) Papadimitriou K., Food Science and Human
            Nutrition, Agricultural University of Athens, 75 Iera Odos str.,
            Athens, 117 55, GREECE
REFERENCE   3  (bases 1 to 6598)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6598)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (01-APR-2014) Papadimitriou K., Food Science and Human Nutrition,
            Agricultural University of Athens, 75 Iera Odos str., Athens, 117
            55, GREECE"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6598
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     142..158
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     rep_origin      559..800
                     /label="predicted ori of plasmid pSMA198"
                     /note="predicted ori of plasmid pSMA198"
     CDS             833..2026
                     /codon_start=1
                     /gene="rep"
                     /product="Rep protein"
                     /label="rep"
                     /note="replication initiation protein of plasmid pSMA198"
                     /protein_id="CDP22284.1"
                     /translation="MSSIPEKQENQKQVLTLNELSKRKVVEHNSLITSIAKMDKTPLKM
                     FELAVSCINTEEPPKDNIVYLSKRDLFAFFKVSDNDKHSRFKEAIEKMQKQAFFQIKEE
                     AGKGFKFKSIVPIPYVEWTDYHDEVKIEFHREIMPYLINLKKNFTQHALSDLAELNSKY
                     SIILYRWLSMNYNQYEHYSAKGGRRAEQVESYQNPSISIKELRIMTDTVNDYERFQSLE
                     TWILKKPLEEINAHTSFNVTYDKIKKGRSIDSIVFHIEKKRCADDNSYKLNDKMYQAEQ
                     AKKEETEDMLAIEAMKNKYTKLLLDNMLLNSYEMTDTAIMAGLQQHVYPLYDELKDLHG
                     IKAVQDHLSYVASKQEAYSKRNIAKYLKKAIEQYLPTVRGSEIENMADLLKKIEGKA"
     gene            833..2026
                     /gene="rep"
                     /label="rep"
     CDS             2023..2607
                     /codon_start=1
                     /product="OrfX"
                     /label="OrfX"
                     /note="ORFX; orfX of plasmid pSMA198"
                     /protein_id="CDP22285.1"
                     /translation="MSEDLKTIKELADEFNVSKQAVRKRLTEEFRANHVETVTSNGVKT
                     LVVTYTGYMLLKQHFTTSNATGNDKVTDTSNPTTGDLSVVKILEQQLFVKDKQLENKDS
                     QISQMQNLLDQQQRLALQDKKLLEEYKAENDSLKALKMPSQETEFKHLDNQYKDEVNAL
                     KEKLENLQEQLKEKDQELAQEKSKKWYQFWK"
     CDS             3319..4053
                     /gene="ermBP"
                     /label="rRNA adenine N-6-methyltransferase"
                     /note="rRNA adenine N-6-methyltransferase from Enterococcus
                     faecalis. Accession#: P0A4D5"
     primer_bind     complement(4140..4156)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    complement(4164..4180)
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(4188..4218)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(4233..4254)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(4542..5130)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(5304..6161)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(6162..6266)
                     /label="AmpR promoter"

This page is informational only.