Basic Vector Information
- Vector Name:
- pOKvtpKO
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7541 bp
- Type:
- Inactivation vector
- Replication origin:
- p15A ori
- Source/Author:
- Battisti JM, Raffel SJ, Schwan TG.
pOKvtpKO vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pOKvtpKO vector Sequence
LOCUS 40924_33752 7541 bp DNA circular SYN 18-DEC-2018
DEFINITION Inactivation vector pOKvtpKO, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 7541)
AUTHORS Battisti JM, Raffel SJ, Schwan TG.
TITLE A System for Site-Specific Genetic Manipulation of the Relapsing
Fever Spirochete Borrelia hermsii
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 7541)
AUTHORS Battisti JM, Raffel SJ, Schwan TG.
TITLE Direct Submission
JOURNAL Submitted (09-MAR-2007) Laboratory of Zoonotic Pathogens, Rocky
Mountain Laboratories, National Institute of Allergy and Infectious
Diseases, National Institutes of Health, 903 S. 4th Street,
Hamilton, MT 59840, USA
REFERENCE 3 (bases 1 to 7541)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 7541)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(09-MAR-2007) Laboratory of Zoonotic Pathogens, Rocky Mountain
Laboratories, National Institute of Allergy and Infectious Diseases,
National Institutes of Health, 903 S. 4th Street, Hamilton, MT
59840, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..7541
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin complement(51..595)
/direction=LEFT
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
CDS 805..1611
/label=KanR
/note="aminoglycoside phosphotransferase"
misc_feature complement(1727..2512)
/note="similar to thymidylate synthase; 3' end of gene is
not cloned into the vector"
gene 1727..2512
/gene="thyX"
/label=thyX
/note="orfZ"
CDS complement(2796..3686)
/codon_start=1
/product="hypothetical protein"
/label=hypothetical protein
/note="orfY"
/protein_id="ABS71244.1"
/translation="MKKSILTVCMFILLCLLSCDIDALNDLLSKAREKFLEENKNIEGS
DHKQEGKEEQVDVVKNMEEGVRQVVQGDPVAPVDDAIPAFQYPQQETIEIEEKDLIPST
KEEKEAQEEIEKVKSVLEDSKFDQLIENSRKLQSESKQLESDFYRIFSELQTKLQEQRS
LPKINSQTDRAKIQELIKLQNRFNEKRTQIDMLMTQVDAGFNERSSAKYFFEEAEKTLK
EAITERLKNALRSSFRRVANYLSGQLSREARRYAENSLSLLESSSGKIGEAMGIRKDIE
ELIKEAKSYLSSLVR"
regulatory 4175..4295
/label=flgB promoter derived from Borrelia hermsii
/note="flgB promoter derived from Borrelia hermsii"
/regulatory_class="promoter"
CDS 4296..5102
/label=KanR
/note="aminoglycoside phosphotransferase"
CDS 6073..6603
/codon_start=1
/product="hypothetical protein"
/label=hypothetical protein
/note="orfX"
/protein_id="ABS71246.1"
/translation="MSFSFKNFKLTKMLFIFLLAACSSLQVEHDKINNKVRIYQYLNEN
FELKGVVDHQNNTTQIFLYTKIRNHSIVKQTPLILPDGTKIEGKTSYEYDSKASLGKWV
NASSFSLNKAILKKILNEDEHVYNKEDIKVQVGLETLKINKAKIIEFLSKLNAIEKQHT
QKQHPDKQNTHKQ"
This page is informational only.