pOKvtpKO vector (V004234)

LOCUS       40924_33752        7541 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Inactivation vector pOKvtpKO, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7541)
  AUTHORS   Battisti JM, Raffel SJ, Schwan TG.
  TITLE     A System for Site-Specific Genetic Manipulation of the Relapsing 
            Fever Spirochete Borrelia hermsii
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7541)
  AUTHORS   Battisti JM, Raffel SJ, Schwan TG.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAR-2007) Laboratory of Zoonotic Pathogens, Rocky 
            Mountain Laboratories, National Institute of Allergy and Infectious 
            Diseases, National Institutes of Health, 903 S. 4th Street, 
            Hamilton, MT 59840, USA
REFERENCE   3  (bases 1 to 7541)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7541)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (09-MAR-2007) Laboratory of Zoonotic Pathogens, Rocky Mountain 
            Laboratories, National Institute of Allergy and Infectious Diseases,
            National Institutes of Health, 903 S. 4th Street, Hamilton, MT 
            59840, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7541
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(51..595)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             805..1611
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     misc_feature    complement(1727..2512)
                     /note="similar to thymidylate synthase; 3' end of gene is
                     not cloned into the vector"
     gene            1727..2512
                     /gene="thyX"
                     /label=thyX
                     /note="orfZ"
     CDS             complement(2796..3686)
                     /codon_start=1
                     /product="hypothetical protein"
                     /label=hypothetical protein
                     /note="orfY"
                     /protein_id="ABS71244.1"
                     /translation="MKKSILTVCMFILLCLLSCDIDALNDLLSKAREKFLEENKNIEGS
                     DHKQEGKEEQVDVVKNMEEGVRQVVQGDPVAPVDDAIPAFQYPQQETIEIEEKDLIPST
                     KEEKEAQEEIEKVKSVLEDSKFDQLIENSRKLQSESKQLESDFYRIFSELQTKLQEQRS
                     LPKINSQTDRAKIQELIKLQNRFNEKRTQIDMLMTQVDAGFNERSSAKYFFEEAEKTLK
                     EAITERLKNALRSSFRRVANYLSGQLSREARRYAENSLSLLESSSGKIGEAMGIRKDIE
                     ELIKEAKSYLSSLVR"
     regulatory      4175..4295
                     /label=flgB promoter derived from Borrelia hermsii
                     /note="flgB promoter derived from Borrelia hermsii"
                     /regulatory_class="promoter"
     CDS             4296..5102
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     CDS             6073..6603
                     /codon_start=1
                     /product="hypothetical protein"
                     /label=hypothetical protein
                     /note="orfX"
                     /protein_id="ABS71246.1"
                     /translation="MSFSFKNFKLTKMLFIFLLAACSSLQVEHDKINNKVRIYQYLNEN
                     FELKGVVDHQNNTTQIFLYTKIRNHSIVKQTPLILPDGTKIEGKTSYEYDSKASLGKWV
                     NASSFSLNKAILKKILNEDEHVYNKEDIKVQVGLETLKINKAKIIEFLSKLNAIEKQHT
                     QKQHPDKQNTHKQ"