Basic Vector Information
- Vector Name:
- pOGOduet
- Antibiotic Resistance:
- Tetracycline
- Length:
- 9967 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Goldbeck O, Seibold GM.
pOGOduet vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pOGOduet vector Sequence
LOCUS 40924_33732 9967 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pOGOduet, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9967) AUTHORS Goldbeck O, Seibold GM. TITLE Construction of pOGOduet - An inducible, bicistronic vector for synthesis of recombinant proteins in Corynebacterium glutamicum JOURNAL Plasmid 95, 11-15 (2018) PUBMED 29331350 REFERENCE 2 (bases 1 to 9967) AUTHORS Goldbeck O, Seibold GM. TITLE Direct Submission JOURNAL Submitted (27-NOV-2017) Institute of Microbiology and Biotechnology, Ulm University, Albert-Einstein-Allee 11, Ulm, BW 89081, Germany REFERENCE 3 (bases 1 to 9967) TITLE Direct Submission REFERENCE 4 (bases 1 to 9967) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid 95, 11-15 (2018)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-NOV-2017) Institute of Microbiology and Biotechnology, Ulm University, Albert-Einstein-Allee 11, Ulm, BW 89081, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9967 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(1650..2273) /codon_start=1 /label=TetR /note="tetracycline repressor TetR" /translation="MMSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWH VKNKRALLDALAIEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGT RPTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEDQEHQVAKEERETPT TDSMPPLLRQAIELFDHQGAEPAFLFGLELIICGLEKQLKCESGS" protein_bind 2805..2823 /label=tet operator /note="bacterial operator O1 for the tetR and tetA genes" protein_bind 2839..2855 /label=tet operator /bound_moiety="tetracycline repressor TetR" /note="bacterial operator O1 for the tetR and tetA genes" primer_bind complement(2940..2956) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" terminator 3169..3255 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 3347..3374 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 3393..3484 /label=AmpR promoter primer_bind complement(3805..3821) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind 3829..3845 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3853..3883) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(3898..3919) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(4040..5068) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ASA" promoter complement(5069..5146) /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." promoter 5380..5408 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 5416..5432 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind complement(5536..5552) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" terminator complement(5768..5811) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 5943..5970 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" rep_origin complement(6235..6823) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 7056..7868 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
This page is informational only.