Basic Vector Information
- Vector Name:
- pNZ4
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9809 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Zhang N, Magee BB, Magee PT, Cannon R, Schmid J.
pNZ4 vector Map
pNZ4 vector Sequence
LOCUS 40924_33697 9809 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pNZ4, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 9809)
AUTHORS Zhang N, Magee BB, Magee PT, Cannon R, Schmid J.
TITLE A method for mating clinical Candida albicans isolates
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 9809)
AUTHORS Zhang N, Magee BB, Magee PT, Cannon R, Schmid J.
TITLE Direct Submission
JOURNAL Submitted (04-MAR-2009) IMBS, Massey University, Riddet Road,
Palmerston North 4410, New Zealand
REFERENCE 3 (bases 1 to 9809)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 9809)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(04-MAR-2009) IMBS, Massey University, Riddet Road, Palmerston North
4410, New Zealand"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..9809
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin complement(3..458)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 600..616
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 626..644
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
mobile_element 683..1491
/mobile_element_type="insertion sequence:TS1"
/label=insertion sequence:TS1
/note="from Candida albicans chromosome 7"
terminator 1644..1831
/label=ADH1 terminator
/note="transcription terminator for the S. cerevisiae
alcohol dehydrogenase 1 (ADH1) gene"
promoter 1852..1907
/label=tetR/tetA promoters
/note="overlapping promoters for bacterial tetR and tetA"
misc_feature 2083..4189
/label=IMH3r ORF plus terminator from plasmid p3408
/note="IMH3r ORF plus terminator from plasmid p3408"
CDS join(2083..2533,2781..3895)
/codon_start=1
/product="IMH3r"
/label=IMH3r
/protein_id="ACY78684.1"
/translation="MVFETSKATSYLKDYPKKDGLSVKELIDSTNFGGLTYNDFLILPG
LVNFPSSAVSLETKLTKKITLKSPFVSSPMDTVTEENMAIHMALLGGIGIIHHNCTAEE
QAEMVRKVKKYENGFINDPVVISPEVTVGEVKKMGEVLGFTSFPVTENGKVGGKLVGII
TSRDIQFHEDNKSPVSEVMTKDLVVGKKGISLTDGNELLRSSKKGKLPIVDAEGNLVSL
ISRTDLQKNQDYPNASKSFHSKQLLCGAAIGTIDADRERLDKLVEAGLDVVVLDSSNGS
SVFQLNMIKWIKEKYPELQVIAGNVVTREQAALLIEAGADALRIGMGSGSICITQEVMA
CGRPQGTAVYGVTEFANKFGVPCIADGGIGNIGHITKALALGASCVMMGGLLAGTAETP
DDYFYRDGKRLKTYRGMGSIDAMQQTNTNANASTSRYFSEADKVLVAQGVSGSVVDKGS
ITKFVPYLYNGLQHSLQDIGIKSIDELRENVDNGEIRFEFRTASAQFEGGVHGLHSYEK
RLHN"
CDS complement(4462..4542)
/label=3xHA
/note="three tandem HA epitope tags"
CDS complement(5239..5859)
/label=TetR
/note="tetracycline repressor TetR"
regulatory 5860..6387
/label=PENO1 from plasmid pCAITHE5
/note="PENO1 from plasmid pCAITHE5"
/regulatory_class="promoter"
mobile_element 6404..7560
/mobile_element_type="insertion sequence:TS2"
/label=insertion sequence:TS2
/note="from Candida albicans chromosome 7"
primer_bind complement(7575..7591)
/label=KS primer
/note="common sequencing primer, one of multiple similar
variants"
promoter complement(7621..7639)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(7660..7676)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(7684..7700)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(7708..7738)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(7753..7774)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(8062..8650)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(8824..9681)
/label=AmpR
/note="beta-lactamase"
promoter complement(9682..9786)
/label=AmpR promoter
This page is informational only.