Basic Vector Information
- Vector Name:
- pNZ4
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9809 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Zhang N, Magee BB, Magee PT, Cannon R, Schmid J.
pNZ4 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNZ4 vector Sequence
LOCUS 40924_33697 9809 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pNZ4, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 9809)
AUTHORS Zhang N, Magee BB, Magee PT, Cannon R, Schmid J.
TITLE A method for mating clinical Candida albicans isolates
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 9809)
AUTHORS Zhang N, Magee BB, Magee PT, Cannon R, Schmid J.
TITLE Direct Submission
JOURNAL Submitted (04-MAR-2009) IMBS, Massey University, Riddet Road,
Palmerston North 4410, New Zealand
REFERENCE 3 (bases 1 to 9809)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 9809)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(04-MAR-2009) IMBS, Massey University, Riddet Road, Palmerston North
4410, New Zealand"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..9809
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin complement(3..458)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 600..616
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 626..644
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
mobile_element 683..1491
/mobile_element_type="insertion sequence:TS1"
/label=insertion sequence:TS1
/note="from Candida albicans chromosome 7"
terminator 1644..1831
/label=ADH1 terminator
/note="transcription terminator for the S. cerevisiae
alcohol dehydrogenase 1 (ADH1) gene"
promoter 1852..1907
/label=tetR/tetA promoters
/note="overlapping promoters for bacterial tetR and tetA"
misc_feature 2083..4189
/label=IMH3r ORF plus terminator from plasmid p3408
/note="IMH3r ORF plus terminator from plasmid p3408"
CDS join(2083..2533,2781..3895)
/codon_start=1
/product="IMH3r"
/label=IMH3r
/protein_id="ACY78684.1"
/translation="MVFETSKATSYLKDYPKKDGLSVKELIDSTNFGGLTYNDFLILPG
LVNFPSSAVSLETKLTKKITLKSPFVSSPMDTVTEENMAIHMALLGGIGIIHHNCTAEE
QAEMVRKVKKYENGFINDPVVISPEVTVGEVKKMGEVLGFTSFPVTENGKVGGKLVGII
TSRDIQFHEDNKSPVSEVMTKDLVVGKKGISLTDGNELLRSSKKGKLPIVDAEGNLVSL
ISRTDLQKNQDYPNASKSFHSKQLLCGAAIGTIDADRERLDKLVEAGLDVVVLDSSNGS
SVFQLNMIKWIKEKYPELQVIAGNVVTREQAALLIEAGADALRIGMGSGSICITQEVMA
CGRPQGTAVYGVTEFANKFGVPCIADGGIGNIGHITKALALGASCVMMGGLLAGTAETP
DDYFYRDGKRLKTYRGMGSIDAMQQTNTNANASTSRYFSEADKVLVAQGVSGSVVDKGS
ITKFVPYLYNGLQHSLQDIGIKSIDELRENVDNGEIRFEFRTASAQFEGGVHGLHSYEK
RLHN"
CDS complement(4462..4542)
/label=3xHA
/note="three tandem HA epitope tags"
CDS complement(5239..5859)
/label=TetR
/note="tetracycline repressor TetR"
regulatory 5860..6387
/label=PENO1 from plasmid pCAITHE5
/note="PENO1 from plasmid pCAITHE5"
/regulatory_class="promoter"
mobile_element 6404..7560
/mobile_element_type="insertion sequence:TS2"
/label=insertion sequence:TS2
/note="from Candida albicans chromosome 7"
primer_bind complement(7575..7591)
/label=KS primer
/note="common sequencing primer, one of multiple similar
variants"
promoter complement(7621..7639)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(7660..7676)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(7684..7700)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(7708..7738)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(7753..7774)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(8062..8650)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(8824..9681)
/label=AmpR
/note="beta-lactamase"
promoter complement(9682..9786)
/label=AmpR promoter
This page is informational only.