Basic Vector Information
- Vector Name:
- pNV18Sm
- Antibiotic Resistance:
- Streptomycin
- Length:
- 5567 bp
- Type:
- Dietzia-Escherichia shuttle vector
- Replication origin:
- ori
- Source/Author:
- Szvetnik A, Bihari Z, Szabo Z, Kelemen O, Kiss I.
pNV18Sm vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNV18Sm vector Sequence
LOCUS 40924_33657 5567 bp DNA circular SYN 18-DEC-2018 DEFINITION Dietzia-Escherichia shuttle vector pNV18Sm, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5567) AUTHORS Szvetnik A, Bihari Z, Szabo Z, Kelemen O, Kiss I. TITLE Genetic manipulation tools for Dietzia spp JOURNAL J. Appl. Microbiol. 109 (5), 1845-1852 (2010) PUBMED 20666867 REFERENCE 2 (bases 1 to 5567) AUTHORS Bihari Z, Szvetnik A. TITLE Direct Submission JOURNAL Submitted (18-AUG-2009) Dep. of Appl. Microbiol., BAYBIO, Derkovits fasor 2., Szeged, Csongrad H-6726, Hungary REFERENCE 3 (bases 1 to 5567) AUTHORS Bihari Z, Szvetnik A. TITLE Direct Submission JOURNAL Submitted (23-FEB-2011) Dep. of Appl. Microbiol., BAYBIO, Derkovits fasor 2., Szeged, Csongrad H-6726, Hungary REFERENCE 4 (bases 1 to 5567) TITLE Direct Submission REFERENCE 5 (bases 1 to 5567) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Appl. Microbiol."; date: "2010"; volume: "109"; issue: "5"; pages: "1845-1852" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-AUG-2009) Dep. of Appl. Microbiol., BAYBIO, Derkovits fasor 2., Szeged, Csongrad H-6726, Hungary" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (23-FEB-2011) Dep. of Appl. Microbiol., BAYBIO, Derkovits fasor 2., Szeged, Csongrad H-6726, Hungary" COMMENT SGRef: number: 4; type: "Journal Article" COMMENT On Feb 23, 2011 this sequence version replaced GQ495223.1. FEATURES Location/Qualifiers source 1..5567 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 859..1647 /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin 2273..2861 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 3149..3170 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 3185..3215 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 3223..3239 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 3247..3263 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" misc_feature 3273..3329 /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(3333..3349) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS 3896..4822 /codon_start=1 /gene="repA" /product="RepA" /label=repA /note="replication protein" /protein_id="ACV66989.1" /translation="MSHVADEFEQLWLPYWPLASDDLLEGIYRQSRASALGRRYIEANP TALANLLVVDVDHPDAALRALSARGSHPLPNAIVGNRANGHAHAVWALNAPVPRTEYAR RKPLAYMAACAEGLRRAVDGDRSYSGLMTKNPGHIAWETEWLHSDLYTLSHIEAELGAN MPPPRWRQQTTYKAAPTPLGRNCALFDSVRLWAYRPALMRIYLPTRNVDGLGRAIYAEC HARNAEFPCNDVCPGPLPDSEVRAIANSIWRWITTKSRIWADGIVVYEATLSARQSAIS RKGAAARTAASTVARRAKSASAMEALL" gene 3896..4822 /gene="repA" /label=repA CDS 4819..5154 /codon_start=1 /gene="repB" /product="RepB" /label=repB /note="replication protein" /protein_id="ACV66990.2" /translation="MSDGYNRQPTVRKKRRVTAAEGARITGLSERHVVRLVAQERSEWL AEQAARRERIRAYHDDEGHSWPQTAKHFGLHLDTVKRLGYRARKERAAEQEAAQKAHNE ADNPPLF" gene 4819..5154 /gene="repB" /label=repB
This page is informational only.