pNSVirB vector (V004271)

MSDS

Basic Vector Information

Vector Name:: pNSVirB

Antibiotic Resistance:: Chloramphenicol

Length:: 3194 bp

Type:: Brucella expression vector

Replication origin:: pBBR1 oriV

Source/Author:: Seleem MN, Jain N, Alqublan H, Vemulapalli R, Boyle SM, Sriranganathan N.

pNSVirB vector Vector Map

View Map in NovoBuilder

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pNSVirB vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_33537        3194 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Brucella expression vector pNSVirB, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3194)
  AUTHORS   Seleem MN, Jain N, Alqublan H, Vemulapalli R, Boyle SM, 
            Sriranganathan N.
  TITLE     Activity of native vs. synthetic promoters in Brucella
  JOURNAL   FEMS Microbiol. Lett. 288 (2), 211-215 (2008)
  PUBMED    18811654
REFERENCE   2  (bases 1 to 3194)
  AUTHORS   Seleem MN, Sriranganathan N.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-MAY-2008) ICTAS, Virginia Tech, 1410 Prices Fork Rd., 
            Blacksburg, VA 24061, USA
REFERENCE   3  (bases 1 to 3194)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3194)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "FEMS 
            Microbiol. Lett."; date: "2008"; volume: "288"; issue: "2"; pages: 
            "211-215"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (06-MAY-2008) ICTAS, Virginia Tech, 1410 Prices Fork Rd., 
            Blacksburg, VA 24061, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3194
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             508..525
                     /codon_start=1
                     /label=6xHis
                     /note="6xHis affinity tag"
                     /translation="HHHHHH"
     promoter        689..791
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             792..1424
                     /codon_start=1
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQF"
     CDS             complement(1542..2201)
                     /codon_start=1
                     /label=pBBR1 Rep
                     /note="replication protein for the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica"
                     /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH
                     HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV
                     NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE
                     PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR"
     rep_origin      complement(2202..2971)
                     /direction=LEFT
                     /label=pBBR1 oriV
                     /note="replication origin of the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica; requires the pBBR1 
                     Rep protein for replication"

This page is informational only.