Basic Vector Information
- Vector Name:
- pNSHtrA
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3022 bp
- Type:
- Brucella expression vector
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Seleem MN, Jain N, Alqublan H, Vemulapalli R, Boyle SM, Sriranganathan N.
pNSHtrA vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNSHtrA vector Sequence
LOCUS 40924_33532 3022 bp DNA circular SYN 18-DEC-2018 DEFINITION Brucella expression vector pNSHtrA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3022) AUTHORS Seleem MN, Jain N, Alqublan H, Vemulapalli R, Boyle SM, Sriranganathan N. TITLE Activity of native vs. synthetic promoters in Brucella JOURNAL FEMS Microbiol. Lett. 288 (2), 211-215 (2008) PUBMED 18811654 REFERENCE 2 (bases 1 to 3022) AUTHORS Seleem MN, Sriranganathan N. TITLE Direct Submission JOURNAL Submitted (06-MAY-2008) ICTAS, Virginia Tech, 1410 Prices Fork Rd., Blacksburg, VA 24061, USA REFERENCE 3 (bases 1 to 3022) TITLE Direct Submission REFERENCE 4 (bases 1 to 3022) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "FEMS Microbiol. Lett."; date: "2008"; volume: "288"; issue: "2"; pages: "211-215" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-MAY-2008) ICTAS, Virginia Tech, 1410 Prices Fork Rd., Blacksburg, VA 24061, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3022 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 336..353 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" promoter 517..619 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 620..1252 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQF" CDS complement(1370..2029) /codon_start=1 /label=pBBR1 Rep /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica" /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR" rep_origin complement(2030..2799) /direction=LEFT /label=pBBR1 oriV /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication"
This page is informational only.