Basic Vector Information
- Vector Name:
- pNR-46131
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5824 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Charpentier E, Anton AI, Barry P, Alfonso B, Fang Y, Novick RP.
pNR-46131 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNR-46131 vector Sequence
LOCUS 40924_33487 5824 bp DNA circular SYN 18-DEC-2018
DEFINITION Shuttle vector pNR-46131, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5824)
AUTHORS Charpentier E, Anton AI, Barry P, Alfonso B, Fang Y, Novick RP.
TITLE Novel cassette-based shuttle vector system for gram-positive
bacteria
JOURNAL Appl. Environ. Microbiol. 70 (10), 6076-6085 (2004)
PUBMED 15466553
REFERENCE 2 (bases 1 to 5824)
AUTHORS Riojas MA, Bojja K, Farley T, Moreno J, Pederson C, Byrd R, Hamid S,
Mooney S, Hazbon MH.
TITLE Direct Submission
JOURNAL Submitted (09-DEC-2014) BEI Bacteriology, BEI Resources/American
Type and Culture Collection (ATCC), 10801 University Boulevard,
Manassas, VA 20110-2209, USA
REFERENCE 3 (bases 1 to 5824)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5824)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
Environ. Microbiol."; date: "2004"; volume: "70"; issue: "10";
pages: "6076-6085"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(09-DEC-2014) BEI Bacteriology, BEI Resources/American Type and
Culture Collection (ATCC), 10801 University Boulevard, Manassas, VA
20110-2209, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Assembly Method :: CLC Genomics Workbench v. 7.0.2
Coverage :: 11,677.82
Sequencing Technology :: Illumina
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..5824
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind 1316..1332
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 1333..1377
/note="HindIII-SphI-PstI-SalI-XbaI-BamHI-SmaI-KpnI-SacI-
EcoRI; polylinker of M13mp19"
regulatory complement(1378..1511)
/note="constitutive beta-lactamase promoter; P_blaZ"
/regulatory_class="promoter"
rep_origin complement(1648..2236)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(2410..3267)
/label=AmpR
/note="beta-lactamase"
promoter complement(3268..3372)
/label=AmpR promoter
CDS complement(3740..4471)
/gene="ermC"
/label=ermC
/note="rRNA adenine N-6-methyltransferase from
Staphylococcus aureus. Accession#: P02979"
CDS complement(4899..5204)
/codon_start=1
/product="truncated polypeptide B"
/label=truncated polypeptide B
/protein_id="AJF23042.1"
/translation="MFSLYKKFKGLFYSVLFWLCILSFFSVLNEMVLNVSLPDIANHFN
TTPGITNWVNTAYMLTFSIGTAVYGKLSDYINIKKLLIIGISLSCLGSLIAFIGPT"
This page is informational only.