pNR-46131 vector (V004281)

LOCUS       V004281                 5824 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004281
VERSION     V004281
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 5824)
  AUTHORS   Charpentier E, Anton AI, Barry P, Alfonso B, Fang Y, Novick RP.
  TITLE     Novel cassette-based shuttle vector system for gram-positive
            bacteria
  JOURNAL   Appl. Environ. Microbiol. 70 (10), 6076-6085 (2004)
   PUBMED   15466553
REFERENCE   2  (bases 1 to 5824)
  AUTHORS   Riojas MA, Bojja K, Farley T, Moreno J, Pederson C, Byrd R, Hamid S,
            Mooney S, Hazbon MH.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-DEC-2014) BEI Bacteriology, BEI Resources/American
            Type and Culture Collection (ATCC), 10801 University Boulevard,
            Manassas, VA 20110-2209, USA
REFERENCE   3  (bases 1 to 5824)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5824)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: CLC Genomics Workbench v. 7.0.2
            Coverage              :: 11,677.82
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
            Environ. Microbiol."; date: "2004"; volume: "70"; issue: "10";
            pages: "6076-6085"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (09-DEC-2014) BEI Bacteriology, BEI Resources/American Type and
            Culture Collection (ATCC), 10801 University Boulevard, Manassas, VA
            20110-2209, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5824
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     1316..1332
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     misc_feature    1333..1377
                     /note="HindIII-SphI-PstI-SalI-XbaI-BamHI-SmaI-KpnI-SacI-
                     EcoRI; polylinker of M13mp19"
     regulatory      complement(1378..1511)
                     /note="constitutive beta-lactamase promoter; P_blaZ"
                     /regulatory_class="promoter"
     rep_origin      complement(1648..2236)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(2410..3267)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(3268..3372)
                     /label="AmpR promoter"
     CDS             complement(3740..4471)
                     /gene="ermC"
                     /label="rRNA adenine N-6-methyltransferase"
                     /note="rRNA adenine N-6-methyltransferase from
                     Staphylococcus aureus. Accession#: P02979"
     CDS             complement(4899..5204)
                     /codon_start=1
                     /product="truncated polypeptide B"
                     /label="truncated polypeptide B"
                     /protein_id="AJF23042.1"
                     /translation="MFSLYKKFKGLFYSVLFWLCILSFFSVLNEMVLNVSLPDIANHFN
                     TTPGITNWVNTAYMLTFSIGTAVYGKLSDYINIKKLLIIGISLSCLGSLIAFIGPT"