Basic Vector Information
- Vector Name:
- pNR-46121
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5544 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Charpentier E, Anton AI, Barry P, Alfonso B, Fang Y, Novick RP.
pNR-46121 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNR-46121 vector Sequence
LOCUS 40924_33477 5544 bp DNA circular SYN 18-DEC-2018
DEFINITION Shuttle vector pNR-46121, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5544)
AUTHORS Charpentier E, Anton AI, Barry P, Alfonso B, Fang Y, Novick RP.
TITLE Novel cassette-based shuttle vector system for gram-positive
bacteria
JOURNAL Appl. Environ. Microbiol. 70 (10), 6076-6085 (2004)
PUBMED 15466553
REFERENCE 2 (bases 1 to 5544)
AUTHORS Riojas MA, Bojja K, Hazbon MH.
TITLE pNR-46121, A Shuttle Vector for Gram-Positive Bacteria
JOURNAL Unpublished
REFERENCE 3 (bases 1 to 5544)
AUTHORS Riojas MA, Bojja K, Hazbon MH.
TITLE Direct Submission
JOURNAL Submitted (17-JUN-2014) Bacteriology, BEI Resources/American Type
Culture Collection (ATCC), 10801 University Blvd., Manassas, VA
20110, USA
REFERENCE 4 (bases 1 to 5544)
TITLE Direct Submission
REFERENCE 5 (bases 1 to 5544)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
Environ. Microbiol."; date: "2004"; volume: "70"; issue: "10";
pages: "6076-6085"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
(17-JUN-2014) Bacteriology, BEI Resources/American Type Culture
Collection (ATCC), 10801 University Blvd., Manassas, VA 20110, USA"
COMMENT SGRef: number: 4; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Assembly Method :: CLC Genomics Workbench v. 7.0.2
Sequencing Technology :: Illumina
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..5544
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 1..1417
/note="pT181 cop-wt repC; derived from J01764.1
Staphylococcus aureus plasmid pT181"
CDS 157..960
/codon_start=1
/gene="repC"
/product="replication initiation protein"
/label=repC
/protein_id="AIL56502.1"
/translation="MTIVGNLNRDNAQALSKFMSVEPQIRLWDILQTKFKAKALQEKVY
IEYDKVKADSWDRRNMRIEFNPNKLTRDEMIWLKQNIISYMEDDGFTRLDLAFDFEDDL
SDYYAMSDKAVKKTIFYGRNGKPETKYFGVRDSNRFIRIYNKKQERKDNADAEVMSEHL
WRVEIELKRDMVDYWNDCFSDLHILQPDWKTIQRTADRAIVFMLLSDEEEWGKLHRNSR
TKYKNLIKEISPVDLTDLMKSTLKANEKQLQKQIDFWQHEFKFWK"
gene 157..960
/gene="repC"
/label=repC
misc_feature 1122..1417
/gene="tetK"
/label=truncated tetracycline efflux protein
/note="truncated tetracycline efflux protein"
gene 1122..1417
/gene="tetK"
/label=tetK
CDS 1611..2402
/label=KanR
/note="aminoglycoside phosphotransferase"
promoter 2808..2912
/label=AmpR promoter
CDS 2913..3770
/label=AmpR
/note="beta-lactamase"
rep_origin 3944..4532
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
primer_bind complement(4714..4730)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 4873..5544
/note="pT181 cop-wt repC; derived from J01764.1
Staphylococcus aureus plasmid pT181"
This page is informational only.