Basic Vector Information
- Vector Name:
- pNIA-Ca
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6151 bp
- Type:
- Yeast expression vector
- Replication origin:
- ori
- Source/Author:
- Zaltsman A, Yi BY, Krichevsky A, Gafni Y, Citovsky V.
- Promoter:
- ADH1
pNIA-Ca vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNIA-Ca vector Sequence
LOCUS 40924_33192 6151 bp DNA circular SYN 18-DEC-2018 DEFINITION Yeast expression vector pNIA-Ca, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6151) AUTHORS Zaltsman A, Yi BY, Krichevsky A, Gafni Y, Citovsky V. TITLE Yeast-plant coupled vector system for identification of nuclear proteins JOURNAL Plant Physiol. 145 (4), 1264-1271 (2007) PUBMED 17704231 REFERENCE 2 (bases 1 to 6151) AUTHORS Zaltsman AA, Citovsky V. TITLE Direct Submission JOURNAL Submitted (27-APR-2007) Biochemistry and Cell Bio, State University of New York, Stony Brook, NY 11777, USA REFERENCE 3 (bases 1 to 6151) TITLE Direct Submission REFERENCE 4 (bases 1 to 6151) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant Physiol."; date: "2007"; volume: "145"; issue: "4"; pages: "1264-1271" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-APR-2007) Biochemistry and Cell Bio, State University of New York, Stony Brook, NY 11777, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6151 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 25..630 /codon_start=1 /label=LexA /note="E. coli DNA-binding protein that represses genes involved in the SOS response to DNA damage" /translation="MKALTARQQEVFDLIHDHISQTGMPPTRAEIAQRLGFRSPNAAEE HLKALARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAAGEPLLAQQHIEGHYQVDPSL FKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKGLEKQGN KVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNGDWL" CDS 637..975 /codon_start=1 /label=GAL4 activation domain /note="activation domain of the GAL4 transcriptional activator" /translation="NFNQSGNIADSSLSFTFTNSSNGPNLITTQTNSQALSQPIASSNV HDNFMNNEITASKIDDGNNSKPLSPGWTDQTAYNAFGITTGMFNTTTMDDVYNYLFDDE DTPPNPKKE" misc_feature 997..1062 /label=MCS /note="multiple cloning site" polyA_signal 1186..1307 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" CDS complement(1384..2055) /codon_start=1 /label=TRP1 /note="phosphoribosylanthranilate isomerase, required for tryptophan biosynthesis" /translation="MSVINFTGSSGPLVKVCGLQSTEAAECALDSDADLLGIICVPNRK RTIDPVIARKISSLVKAYKNSSGTPKYLVGVFRNQPKEDVLALVNDYGIDIVQLHGDES WQEYQEFLGLPVIKRLVFPKDCNILLSAASQKPHSFIPLFDSEAGGTGELLDWNSISDW VGRQESPESLHFMLAGGLTPENVGDALRLNGVIGVDVSGGVETNGVKDSNKIANFVKNA KK" promoter complement(2056..2157) /label=TRP1 promoter primer_bind complement(2171..2187) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2195..2211) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2219..2249) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2264..2285) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(2573..3161) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3335..4192) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEAS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(4193..4297) /label=AmpR promoter rep_origin 4579..5743 /label=2u ori /note="yeast 2u plasmid origin of replication" promoter 5753..6149 /label=ADH1 promoter /note="promoter for alcohol dehydrogenase 1"
This page is informational only.