Basic Vector Information
- Vector Name:
- pNG3
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9225 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Gonzalez-Quinonez N, Lopez-Garcia MT, Yague P, Rioseras B, Pisciotta A, Alduina R, Manteca A.
pNG3 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNG3 vector Sequence
LOCUS 40924_33162 9225 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pNG3, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 9225)
AUTHORS Gonzalez-Quinonez N, Lopez-Garcia MT, Yague P, Rioseras B, Pisciotta
A, Alduina R, Manteca A.
TITLE New PhiBT1 site-specific integrative vectors with neutral phenotype
in Streptomyces
JOURNAL Appl. Microbiol. Biotechnol. 100 (6), 2797-2808 (2016)
PUBMED 26758297
REFERENCE 2 (bases 1 to 9225)
AUTHORS Gonzalez-Quinonez N, Lopez-Garcia MT, Yague P, Rioseras B, Manteca
A.
TITLE Direct Submission
JOURNAL Submitted (15-APR-2015) Biologia Funcional, Universidad de Oviedo,
c/Julian Claveria s/n Facultad de Medicina, Oviedo 33006, Spain
REFERENCE 3 (bases 1 to 9225)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 9225)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
Microbiol. Biotechnol."; date: "2016"; volume: "100"; issue: "6";
pages: "2797-2808"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(15-APR-2015) Biologia Funcional, Universidad de Oviedo, c/Julian
Claveria s/n Facultad de Medicina, Oviedo 33006, Spain"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..9225
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin 265..853
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 1141..1162
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 1177..1207
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 1215..1231
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 1239..1255
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
oriT 3480..3589
/label=oriT
/note="incP origin of transfer"
CDS 3622..3990
/label=traJ
/note="oriT-recognizing protein"
CDS complement(4706..5701)
/gene="hyg"
/label=hyg
/note="Hygromycin-B 7''-O-kinase from Streptomyces
hygroscopicus. Accession#: P09979"
CDS complement(6386..7696)
/codon_start=1
/gene="SCO4849"
/product="SCO4849 protein"
/label=SCO4849
/protein_id="AML61765.1"
/translation="MVVVFVLVALLMVGVLVTANWYVWRRLFRDTTRAPGPVRRIGAAV
IAGGWLLAVGALVAERAGAPFWLQRVLAWPGFLWLALSIYLLLAVLAGEVVRPLLRRFL
ERRAAARRTAGAEPSVTPAADTSRIPAGTAPPKTPEAPETPEAPGTEALAAQGSPLAVP
SRRLFVSRVVAGAAAAAAVGTVGYGTYGVLSGPKVKRVTVPLAKLPRAAHGFRIAVVSD
IHLGPVLGRGFAQQVVDTINSTQPDLIAVVGDLVDGSVKDLGPAAAPLARLTARHGAYF
VTGNHEYFSGAEQWVAEVRRLGLLPLENARTELPHFDLAGVNDVAGEDEGQGPDYDRAL
GDRDRSRACVLLAHQPVQIHDAVDHGVDLQLSGHTHGGQLWPGNLIAGAANPTLAGLER
YGDTQLYVSRGAGAWGPPTRVGAPSDITVIELASRQA"
gene complement(6386..7696)
/gene="SCO4849"
/label=SCO4849
regulatory complement(7757..8179)
/regulatory_class="promoter"
CDS complement(8300..9157)
/label=AmpR
/note="beta-lactamase"
promoter complement(9158..9221)
/label=AmpR promoter
This page is informational only.