Basic Vector Information
- Vector Name:
- pNG168
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8960 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- DasSarma S.
- Promoter:
- T3
pNG168 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNG168 vector Sequence
LOCUS 40924_33147 8960 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pNG168, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8960) AUTHORS DasSarma S. TITLE Natural plasmids and plasmid vectors of halophiles JOURNAL (in) DasSarma,S., Fleischmann,E.M., Robb,F.T., Place,A.R., Sowers,K.R. and Schreier,H.J. (Eds.); ARCHAEA, A LABORATORY MANUAL - HALOPHILES: 241-250; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY (1995) REFERENCE 2 (bases 1 to 8960) AUTHORS DasSarma S. TITLE Direct Submission JOURNAL Submitted (06-MAY-2003) Center of Marine Biotechnology, University of Maryland Biotechnology Institute, 701 E. Pratt Street, Suite 236, Baltimore, MD 21202 REFERENCE 3 (bases 1 to 8960) TITLE Direct Submission REFERENCE 4 (bases 1 to 8960) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "(in) DasSarma,S., Fleischmann,E.M., Robb,F.T., Place,A.R., Sowers,K.R. and Schreier,H.J. (Eds.)"; volume: " ARCHAEA, A LABORATORY MANUAL - HALOPHILES"; pages: " 241-250; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY (1995" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-MAY-2003) Center of Marine Biotechnology, University of Maryland Biotechnology Institute, 701 E. Pratt Street, Suite 236, Baltimore, MD 21202" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8960 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 849..3878 /codon_start=1 /gene="repH" /product="RepH" /label=repH /note="replication protein; necessary for replication in haloarchaea" /protein_id="AAP44985.1" /translation="MHTPNQQQGIRKIVPGGTLSTAGITITEVTPRVTEWIPDLLEELL PRSIQSVRKFIRQEDPEVLTHARYNTVYRRLQEETLRFDHQEWCSTTDIWSDAEAEAVE YVESLVEFAVKYSDVDEDDLDELSEYHQQRCKSLKQTLTTISTGRGPLNAGLEALAKGP VRLHDELDDAPQPITLVLDGELWSKLDDRGTGIRALAAIAVLGSTFDVRLVISPALDAA IERRYPDWYDSHLRLTETRETSSVESAGGDGQPSAEQLEEAWEAIQNLPEESGRLRLLR NLPIEGSRDYRDLKQDDEIDVQAGTVGRYILDLEELGLVDIDRRGQYNSASLTGLGQVA VEQYVTTDYRVIHPTQSTLETHLTPTPQPQASTVYPARSDTREGDQPGTAEDWIAATGS PSEGADYVQWLDGPSGVLDAWGMHQRYLAGRRDRGVTLVDDRIERFEDGRVSYLSCFDD DLFVATQWGGPLPTLGRIAGALLSDKALSKILTPSRLGNQFEEINDAVVEQLDREAGEI IRRGHQIGWFSEDEEDYDGWRERIGSVRSLCLQQVGELTNSDDVEARTELLRDLHGLVA SATQLYYAAGVDVTINVRVPDTGMLISDERRLDDFLGFARYTIPKQSVYGIHSGYRMLL EDRPEKLKRRLPYEVDDADSTMHLTASWVFSGSTMIDLHDDIEDAIEMETNEIREAIAN GQESAPVMEIPVQIGNSYSAIRNHVEDYASAKNYQVAHQEDIHEGKQDLERLVRLFLRV LGTEDRPHRACPHDVAEAMLHVAQSSRNYDFITVRDISYGLSNLPTKRLLPELPPTATK LLKTLLDADDPMGRSEIIDTADISESSYDRYINELAAWDIIEPREIEGHRRWEAHLEPW WTPQSDRDEPYADPDPDTGILYAEFPRDVASAVMCHLITHYDLPDLETAYLEGIQPGDD IKALFDDHDRLRRWRPFLWGAFADSDKLERGPSGTAASDSTVVRLGQSPGPDTAQSSFQ DVSETATQRDRLSQPSPGLD" gene 849..3878 /gene="repH" /label=repH protein_bind 4431..4452 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 4467..4497 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 4505..4521 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 4529..4545 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 4566..4584 /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" misc_feature complement(4597..4704) /label=MCS /note="pBluescript multiple cloning site" promoter complement(4713..4731) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(4741..4757) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin 4899..5354 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 5380..5484 /label=AmpR promoter CDS 5485..6342 /label=AmpR /note="beta-lactamase" rep_origin 6516..7104 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(7428..8636) /gene="hmgA" /label=hmgA /note="3-hydroxy-3-methylglutaryl-coenzyme A reductase from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2). Accession#: Q59468"
This page is informational only.