pNFkB-Luc vector (Cat. No.: V004337)
Note: NFkB reporter vector is utilized for detecting NFkB (Nuclear factor of kappa light polypeptide gene) transactivation in a cell-based assay.
- Name:
- pNFkB-Luc
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5711 bp
- Type:
- Reporter vector
- Replication origin:
- ori
- Source/Author:
- Zheng C-F.
- Selection Marker:
- Fluc
- Promoter:
- minP
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Liberatore RA, Goff SP, Nunes I. NF-kappaB activity is constitutively elevated in c-Abl null fibroblasts. Proc Natl Acad Sci U S A. 2009 Oct 20;106(42):17823-8. doi: 10.1073/pnas.0905935106. Epub 2009 Sep 30. PMID: 19805123; PMCID: PMC2754925.
pNFkB-Luc vector (Cat. No.: V004337) Sequence
LOCUS pNFkB-Luc 5711 bp DNA circular SYN 26-DEC-2025
DEFINITION Reporter vector pNFkB-Luc, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5711)
AUTHORS Zheng C-F.
TITLE Direct Submission
JOURNAL Submitted (11-MAR-1998) Technical Services, Stratagene, 11011 N.
Torrey Pines Rd., La Jolla, CA 92037, USA
REFERENCE 2 (bases 1 to 5711)
AUTHORS Zheng C-F.
TITLE Direct Submission
JOURNAL Submitted (20-JAN-1999) Technical Services, Stratagene, 11011 N.
Torrey Pines Rd., La Jolla, CA 92037, USA
REFERENCE 3 (bases 1 to 5711)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5711)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted
(11-MAR-1998) Technical Services, Stratagene, 11011 N. Torrey Pines
Rd., La Jolla, CA 92037, USA"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(20-JAN-1999) Technical Services, Stratagene, 11011 N. Torrey Pines
Rd., La Jolla, CA 92037, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5711
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 32..136
/label=AmpR promoter
CDS 137..994
/label=AmpR
/note="beta-lactamase"
rep_origin 1168..1756
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature complement(1942..2082)
/label=bom
/note="basis of mobility region from pBR322"
polyA_signal 2321..2455
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
polyA_signal 2549..2683
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
misc_feature 2692..2758
/label=NFkB response elements
promoter 2769..2800
/label=minP
/note="minimal TATA-box promoter with low basal activity"
CDS 2827..4476
/label=luciferase
/note="firefly luciferase"
intron 4610..4675
/label=small t intron
/note="SV40 (simian virus 40) small t antigen intron"
CDS 4872..5227
/codon_start=1
/label=SV40 T-ANTIGEN
/translation="MLCLVIELLLALLFTPQRKKLHCYTRKLWKNIL*PL*VGITVIII
TYCFFLLHTGIECLLLITMLKNCVPLAF*FVKGLIRNI*CIVP*LEIIISHTTFVEVLL
ALKNLPHLPLNLKH"
polyA_signal 5250..5384
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"