Basic Vector Information
- Vector Name:
- pNDC_SUB4
- Antibiotic Resistance:
- Kanamycin
- Length:
- 9246 bp
- Type:
- Expression vector
- Replication origin:
- oriV
- Source/Author:
- De Coi N.
pNDC_SUB4 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNDC_SUB4 vector Sequence
LOCUS 40924_33118 9246 bp DNA circular SYN 14-DEC-2018 DEFINITION Expression vector pNDC_SUB4, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9246) AUTHORS De Coi N. TITLE Whole gene expression profiles of dermatophytes during infection and their virulance traits JOURNAL Thesis (2015) Centre Hospitalier Universitaire Vaudois REFERENCE 2 (bases 1 to 9246) AUTHORS De Coi N. TITLE Direct Submission JOURNAL Submitted (27-MAY-2015) Department of Dermatology, Centre Hospitalier de Lausanne (CHUV), Bugnon 48, 1011 Lausanne, SWITZERLAND REFERENCE 3 (bases 1 to 9246) TITLE Direct Submission REFERENCE 4 (bases 1 to 9246) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Thesis (2015) Centre Hospitalier Universitaire Vaudois" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-MAY-2015) Department of Dermatology, Centre Hospitalier de Lausanne (CHUV), Bugnon 48, 1011 Lausanne, SWITZERLAND" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9246 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 273..1064 /label=KanR /note="aminoglycoside phosphotransferase" CDS 1366..2511 /label=trfA /note="trans-acting replication protein that binds to and activates oriV" misc_feature 2640..2664 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" misc_feature 2698..2722 /note="LB T-DNA repeat; left border repeat from nopaline C58 T-DNA" primer_bind 2958..2974 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(3846..4868) /label=HygR /note="aminoglycoside phosphotransferase from E. coli" CDS complement(6263..7486) /codon_start=1 /product="subtilisin-like protease SUB4" /label=subtilisin-like protease SUB4 /note="sub4" /protein_id="CRN13537.1" /translation="MVCLKTLSVFLAAFAAADARAVFKTQGHKNSEMIPDNYIVVMKDG VSQDDFKAHISSVASIHSTNKAKRGTNTQGMKREFDIMNWRGYHGHFDRDTLEEILNDS KVDYVEQDQVVRISGLVTQRSAPSWGLGRVSHRQAGSRDYVFDDSAGRGVTIYGVDTGI DINHQDFRGRARWGTNTADRDNADRHGHGTHTASTFAGTAYGIAKNANIVAVKVLGSDG SGSTSGIIAGINYCVQDAQQRGILGKAAMNLSLGGGFSQANNDAVTRAQNAGIFVAVAA GNDNRDARNYSPASAPAVCTVASSTINDSKSSFSNWGPVELKANITSVDIYAPGSDIIA ARPGGGSTTMSGTSMASPHVAGMGAYMIGMGADPRQVCDRLKQLATAAIRNPGSSTTNR LLYNGSGQ" misc_feature 8443..8467 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" rep_origin 8606..9237 /label=oriV /note="incP origin of replication"
This page is informational only.