pNB90 vector (V004354)

MSDS

Basic Vector Information

Vector Name:: pNB90

Antibiotic Resistance:: Kanamycin

Length:: 7165 bp

Type:: Cloning vector

Replication origin:: pBBR1 oriV

Source/Author:: Bongio NJ, Lampe DJ.

pNB90 vector Vector Map

View Map in NovoBuilder

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pNB90 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_33028        7165 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pNB90, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7165)
  AUTHORS   Bongio NJ, Lampe DJ.
  TITLE     Inhibition of Plasmodium berghei Development in Mosquitoes by 
            Effector Proteins Secreted from Asaia sp. Bacteria Using a Novel 
            Native Secretion Signal
  JOURNAL   PLoS ONE 10 (12), E0143541 (2015)
  PUBMED    26636338
REFERENCE   2  (bases 1 to 7165)
  AUTHORS   Bongio NJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-SEP-2015) Biology, Shenandoah University, 1460 
            University Drive, Winchester, VA 22601, USA
REFERENCE   3  (bases 1 to 7165)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7165)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; 
            date: "2015"; volume: "10"; issue: "12"; pages: "E0143541"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (13-SEP-2015) Biology, Shenandoah University, 1460 University Drive,
            Winchester, VA 22601, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7165
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             458..1249
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     regulatory      1552..1762
                     /label=nptII
                     /note="nptII"
                     /regulatory_class="promoter"
     CDS             1769..3106
                     /codon_start=1
                     /product="alkaline phosphatase"
                     /label=alkaline phosphatase
                     /note="derived from Escherichia coli"
                     /protein_id="ALR84553.1"
                     /translation="PVLENRAAQGDITAPGGARRLTGDQTAALRDSLSDKPAKNIILLI
                     GDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDYVTDSAASATA
                     WSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAALVAHVTSRK
                     CYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAGEWQGKTLR
                     EQAQARGYQLVSDAASLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGNIDKPAVT
                     CTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQIGETVD
                     LDEAVQRALEFAKKEGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVMVMSYG
                     NSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK"
     CDS             complement(4714..5373)
                     /label=pBBR1 Rep
                     /note="replication protein for the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica"
     rep_origin      complement(5374..6143)
                     /direction=LEFT
                     /label=pBBR1 oriV
                     /note="replication origin of the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica; requires the pBBR1 
                     Rep protein for replication"

This page is informational only.