Basic Vector Information
- Vector Name:
- pNB90
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7165 bp
- Type:
- Cloning vector
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Bongio NJ, Lampe DJ.
pNB90 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNB90 vector Sequence
LOCUS 40924_33028 7165 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pNB90, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7165) AUTHORS Bongio NJ, Lampe DJ. TITLE Inhibition of Plasmodium berghei Development in Mosquitoes by Effector Proteins Secreted from Asaia sp. Bacteria Using a Novel Native Secretion Signal JOURNAL PLoS ONE 10 (12), E0143541 (2015) PUBMED 26636338 REFERENCE 2 (bases 1 to 7165) AUTHORS Bongio NJ. TITLE Direct Submission JOURNAL Submitted (13-SEP-2015) Biology, Shenandoah University, 1460 University Drive, Winchester, VA 22601, USA REFERENCE 3 (bases 1 to 7165) TITLE Direct Submission REFERENCE 4 (bases 1 to 7165) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2015"; volume: "10"; issue: "12"; pages: "E0143541" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-SEP-2015) Biology, Shenandoah University, 1460 University Drive, Winchester, VA 22601, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7165 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 458..1249 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" regulatory 1552..1762 /label=nptII /note="nptII" /regulatory_class="promoter" CDS 1769..3106 /codon_start=1 /product="alkaline phosphatase" /label=alkaline phosphatase /note="derived from Escherichia coli" /protein_id="ALR84553.1" /translation="PVLENRAAQGDITAPGGARRLTGDQTAALRDSLSDKPAKNIILLI GDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDYVTDSAASATA WSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAALVAHVTSRK CYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAGEWQGKTLR EQAQARGYQLVSDAASLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGNIDKPAVT CTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQIGETVD LDEAVQRALEFAKKEGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVMVMSYG NSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK" CDS complement(4714..5373) /label=pBBR1 Rep /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica" rep_origin complement(5374..6143) /direction=LEFT /label=pBBR1 oriV /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication"
This page is informational only.