Basic Vector Information
- Vector Name:
- pMyrCAM
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 6023 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Chang C, Grafsky AJ.
- Promoter:
- GAL1
pMyrCAM vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMyrCAM vector Sequence
LOCUS 40924_32933 6023 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pMyrCAM, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6023)
AUTHORS Chang C, Grafsky AJ.
TITLE Direct Submission
JOURNAL Submitted (28-OCT-1998) Technical Services, Stratagene, 11011 N.
Torrey Pines Rd., La Jolla, CA 92037, USA
REFERENCE 2 (bases 1 to 6023)
AUTHORS Chang C, Grafsky AJ.
TITLE Direct Submission
JOURNAL Submitted (13-JAN-1999) Technical Services, Stratagene, 11011 N.
Torrey Pines Rd., La Jolla, CA 92037, USA
REFERENCE 3 (bases 1 to 6023)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6023)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted
(28-OCT-1998) Technical Services, Stratagene, 11011 N. Torrey Pines
Rd., La Jolla, CA 92037, USA"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(13-JAN-1999) Technical Services, Stratagene, 11011 N. Torrey Pines
Rd., La Jolla, CA 92037, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT On Jan 15, 1999 this sequence version replaced gi:4154310.
FEATURES Location/Qualifiers
source 1..6023
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 22..63
/codon_start=1
/label=myr
/note="N-myristoylation signal from Src kinase (Pellman et
al., 1985; Kaplan et al., 1988)"
/translation="MGSSKSKPKDPSQR"
terminator 129..376
/label=CYC1 terminator
/note="transcription terminator for CYC1"
rep_origin complement(624..1212)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(1378..2034)
/codon_start=1
/label=CmR
/note="chloramphenicol acetyltransferase"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
CDS complement(2482..3282)
/codon_start=1
/label=URA3
/note="orotidine-5'-phosphate decarboxylase, required for
uracil biosynthesis"
/translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL
ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ
YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE
YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD
VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN"
promoter complement(3283..3503)
/label=URA3 promoter
rep_origin complement(4102..4982)
/direction=LEFT
/label=2u ori
/note="yeast 2u plasmid origin of replication"
rep_origin complement(4993..5506)
/direction=LEFT
/label=M13 ori
/note="M13 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 5525..5966
/label=GAL1 promoter
/note="inducible promoter, regulated by Gal4"
promoter 5998..6016
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
This page is informational only.