pmycYACTn vector (V004373)

Basic Vector Information

      • Vector Name:
      • pmycYACTn
      • Antibiotic Resistance:
      • Ampicillin
      • Length:
      • 10135 bp
      • Type:
      • Tri-shuttle cloning vector
      • Replication origin:
      • ori
      • Source/Author:
      • Benders GA, Noskov VN, Denisova EA, Lartigue C, Gibson DG, Assad-Garcia N, Chuang RY, Carrera W, Moodie M, Algire MA, Phan Q, Alperovich N, Vashee S, Merryman C, Venter JC, Smith HO, Glass JI, Hutchis
      • Promoter:
      • HIS3

pmycYACTn vector Vector Map

pmycYACTn10135 bp50010001500200025003000350040004500500055006000650070007500800085009000950010000IS256 transposaseAmpR promoterAmpRoriouter inverted repeatlacZspiralin promotertetMspiralin promoterCEN/ARSHIS3 promoterHIS3inner inverted repeat

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pmycYACTn vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_32928       10135 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Tri-shuttle cloning vector pmycYACTn, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10135)
  AUTHORS   Benders GA, Noskov VN, Denisova EA, Lartigue C, Gibson DG, 
            Assad-Garcia N, Chuang RY, Carrera W, Moodie M, Algire MA, Phan Q, 
            Alperovich N, Vashee S, Merryman C, Venter JC, Smith HO, Glass JI, 
            Hutchison CA III.
  TITLE     Cloning whole bacterial genomes in yeast
  JOURNAL   Nucleic Acids Res. 38 (8), 2558-2569 (2010)
  PUBMED    20211840
REFERENCE   2  (bases 1 to 10135)
  AUTHORS   Benders GA, Gibson DG, Lartigue C, Glass JI.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2010) Synthetic Biology, J. Craig Venter 
            Institute, 10355 Science Center Dr., San Diego, CA 92121, USA
REFERENCE   3  (bases 1 to 10135)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 10135)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic 
            Acids Res."; date: "2010"; volume: "38"; issue: "8"; pages: 
            "2558-2569"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (02-FEB-2010) Synthetic Biology, J. Craig Venter Institute, 10355 
            Science Center Dr., San Diego, CA 92121, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10135
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             84..1256
                     /codon_start=1
                     /product="IS256 transposase"
                     /label=IS256 transposase
                     /protein_id="ADE19325.1"
                     /translation="MTQVHFTLKSEEIQSIIEYSVKDDVSKNILTTVFNQLMENQRTEY
                     IQAKEYERTENRQSQRNGYYERSFTTRVGTLELKVPRTRDGHFSPTVFERYQRNEKALM
                     ASMLEMYVSGVSTRKVSKIVEELCGKSVSKSFVSSLTEQLEPMVNEWQNRLLSEKNYPY
                     LMTDVLYIKVREENRVLSKSCHIAIGITKDGDREIIGFMIQSGESEETWTTFFEYLKER
                     GLQGTELVISDAHKGLVSAIRKSFTNVSWQRCQVHFLRNIFTTIPKKNSKSFREAVKGI
                     FKFTDINLAREAKNRLIHDYIDQPKYSKACASLDDGFEDAFQYTVQGNSHNRLKSTNLI
                     ERLNQEVRRREKIIRIFPNQTSANRLIGAVLMDLHDEWIYSSRKYINFDK"
     promoter        1256..1326
                     /label=AmpR promoter
     CDS             1327..2184
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      2358..2946
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     mobile_element  3103..3128
                     /mobile_element_type="insertion sequence:IS256"
                     /label=insertion sequence:IS256
                     /note="outer inverted repeat"
     CDS             complement(3138..6182)
                     /label=lacZ
                     /note="beta-galactosidase"
     regulatory      complement(6219..6463)
                     /label=spiralin promoter
                     /note="spiralin promoter"
                     /regulatory_class="promoter"
     gene            complement(6464..8428)
                     /gene="tetM"
                     /label=tetM
     CDS             complement(6494..8428)
                     /codon_start=1
                     /gene="tetM"
                     /product="tetM"
                     /label=tetM
                     /protein_id="ADE19326.1"
                     /translation="MEENHMKIINIGVLAHVDAGKTTLTESLLYNSGAITELGSVDKGT
                     TRTDNTLLERQRGITIQTGITSFQWENTKVNIIDTPGHMDFLAEVYRSLSVLDGAILLI
                     SAKDGVQAQTRILFHALRKMGIPTIFFINKIDQNGIDLSTVYQDIKEKLSAEIVIKQKV
                     ELYPNVCVTNFTESEQWDTVIEGNDDLLEKYMSGKSLEALELEQEESIRFQNCSLFPLY
                     HGSAKSNIGIDNLIEVITNKFYSSTHRGPSELCGNVFKIEYTKKRQRLAYIRLYSGVLH
                     LRDSVRVSEKEKIKVTEMYTSINGELCKIDRAYSGEIVILQNEFLKLNSVLGDTKLLPQ
                     RKKIENPHPLLQTTVEPSKPEQREMLLDALLEISDSDPLLRYYVDSTTHEIILSFLGKV
                     QMEVISALLQEKYHVEIEITEPTVIYMERPLKNAEYTIHIEVPPNPFWASIGLSVSPLP
                     LGSGMQYESSVSLGYLNQSFQNAVMEGIRYGCEQGLYGWNVTDCKICFKYGLYYSPVST
                     PADFRMLAPIVLEQVLKKAGTELLEPYLSFKIYAPQEYLSRAYNDAPKYCANIVDTQLK
                     NNEVILSGEIPARCIQEYRSDLTFFTNGRSVCLTELKGYHVTTGEPVCQPRRPNSRIDK
                     VRYMFNKIT"
     regulatory      complement(8435..8757)
                     /label=spiralin promoter
                     /note="spiralin promoter"
                     /regulatory_class="promoter"
     misc_feature    8758..9261
                     /label=CEN/ARS
                     /note="S. cerevisiae CEN6 centromere fused to an
                     autonomously replicating sequence"
     promoter        9262..9449
                     /label=HIS3 promoter
     CDS             9450..10106
                     /label=HIS3
                     /note="imidazoleglycerol-phosphate dehydratase, required
                     for histidine biosynthesis"
     mobile_element  complement(10110..10135)
                     /mobile_element_type="insertion sequence:IS256"
                     /label=insertion sequence:IS256
                     /note="inner inverted repeat"

This page is informational only.