Basic Vector Information
- Vector Name:
- pMycoFos
- Antibiotic Resistance:
- Kanamycin
- Length:
- 12530 bp
- Type:
- Shuttle vector
- Replication origin:
- ori2
- Source/Author:
- Ly MA, Liew EF, Le NB, Coleman NV.
pMycoFos vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMycoFos vector Sequence
LOCUS 40924_32923 12530 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pMycoFos, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 12530) AUTHORS Ly MA, Liew EF, Le NB, Coleman NV. TITLE Construction and evaluation of pMycoFos, a fosmid shuttle vector for Mycobacterium spp. with inducible gene expression and copy number control JOURNAL J. Microbiol. Methods 86 (3), 320-326 (2011) PUBMED 21689690 REFERENCE 2 (bases 1 to 12530) AUTHORS Ly MA, Coleman NV. TITLE Direct Submission JOURNAL Submitted (08-OCT-2010) School of Molecular Bioscience, University of Sydney, Maze Crescent, Darlington, NSW 2006, Australia REFERENCE 3 (bases 1 to 12530) TITLE Direct Submission REFERENCE 4 (bases 1 to 12530) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Microbiol. Methods"; date: "2011"; volume: "86"; issue: "3"; pages: "320-326" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (08-OCT-2010) School of Molecular Bioscience, University of Sydney, Maze Crescent, Darlington, NSW 2006, Australia" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..12530 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 83..1979 /note="oriM; derived from pAL5000" CDS complement(2030..3103) /codon_start=1 /gene="amiC" /product="AmiC" /label=amiC /note="acetamidase regulator" /protein_id="ADR02799.1" /translation="MQDGEVEFRVGLVIPLQGPAGIFAPSCEAVAELAAKEVNDRGGLQ GRKVTIEVLDGGRPGDDVARTVADRLRGHGLDAVTGWHISAVRNRISPVVRDRIPYVYT SLYEGGERTPGVFCTGETPQIQIAPALAWLRDHFGIRSWCLVGDDYIWPRRSAAAARAY CRDLDLELRREIYVPYGTDDFRAPVRKAIASGAQAVLMLLVGQDAVLFNREFARAGGHD RMARFSPLMEENMLLASGAGSTENLYVAAAYFSSLATAGAMDLMGSYVARYGADAPPLN AMAESCYEGLVALEAIFQRAHSPEIPDLMASAHDVGFDGPRGPMCMRDSQFDQQVYIAS ADGYDFDILDTLTTLDA" gene complement(2030..3103) /gene="amiC" /label=amiC CDS 3206..3634 /codon_start=1 /gene="amiA" /product="AmiA" /label=amiA /note="acetamidase regulator" /protein_id="ADR02800.1" /translation="MAAGQQRRPNLLLPLVRLTHLAESAIERVLADSSLKIEDWRVLDE LAGRRTVPMSDLAQATLITGPTLTRTVDRLVSQGIIYRTADLHDRRRVLVALTPRGRTL RNRLVDAVAEAECAAFESCGLDVDQLRELVDTTSNLTS" gene 3206..3634 /gene="amiA" /label=amiA CDS 3714..3998 /codon_start=1 /gene="amiD" /product="AmiD" /label=amiD /note="acetamidase regulator" /protein_id="ADR02801.1" /translation="MPTYTFRCSHCGPFDLTCAISERDAAATCPECRTPARRVFGSVGL TTFTAGHHRAFDAASASAESPTVVKSIPAGADRPRAPRRNPGLPSLPRY" gene 3714..3998 /gene="amiD" /label=amiD CDS 4003..4644 /codon_start=1 /gene="amiS" /product="AmiS" /label=amiS /note="acetamidase transporter" /protein_id="ADR02802.1" /translation="MGGVGLFYVGAVLIIDGLMLLGRISPRGATPLNFFVGGLQVVTPT VLILQSGGDAAVIFAASGLYLFGFTYLWVAINNVTDWDGEGLGWFSLFVAIAALGYSWH AFTAEADPAFGVIWLLWAVLWFMLFLLLGLGHDALGPAVGFVAVAEGVITAAVPAFLIV SGNWETGPLPAAVIAVIGFAAVVLAYPIGRRLAAPSVTNPPPAALAATTR" gene 4003..4644 /gene="amiS" /label=amiS CDS 4802..5614 /label=KanR /note="aminoglycoside phosphotransferase" CDS 5757..6104 /codon_start=1 /gene="resD" /product="ResD" /label=resD /note="F plasmid resolvase" /protein_id="ADR02804.1" /translation="MERRNRRTGRTEKARIWEVTDRTVRTWIGEAVAAAAADGVTFSVP VTPHTFRHSYAMHMLYAGIPLKVLQSLMGHKSISSTEVYTKVFALDVAARHRVQFAMPE SDAVAMLKQLS" gene 5757..6104 /gene="resD" /label=resD rep_origin 6499..7113 /label=oriV /note="origin of replication for the bacterial F plasmid" rep_origin 7189..7408 /label=ori2 /note="secondary origin of replication for the bacterial F plasmid; also known as oriS" CDS 7499..8251 /label=repE /note="replication initiation protein for the bacterial F plasmid" misc_feature 8257..8507 /label=incC /note="incompatibility region of the bacterial F plasmid" CDS 8833..10005 /label=sopA /note="partitioning protein for the bacterial F plasmid" CDS 10008..10976 /label=sopB /note="partitioning protein for the bacterial F plasmid" misc_feature 11052..11525 /label=sopC /note="centromere-like partitioning region of the bacterial F plasmid" misc_feature complement(11785..12183) /label=cos /note="lambda cos site; allows packaging into phage lambda particles" protein_bind complement(12201..12234) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)."
This page is informational only.