Basic Vector Information
- Vector Name:
- pMVAX1(c)
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3675 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Du Y, Lu Y, Wang X, Qi J, Liu J, Hu Y, Li F, Wu J, Guo L, Liu J, Tao H, Sun W, Chen L, Cong X, Ren S, Shi J, Li J, Wang J, Huang B, Wan R.
pMVAX1(c) vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMVAX1(c) vector Sequence
LOCUS 40924_32783 3675 bp DNA circular SYN 18-DEC-2018
DEFINITION Expression vector pMVAX1(c), complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3675)
AUTHORS Du Y, Lu Y, Wang X, Qi J, Liu J, Hu Y, Li F, Wu J, Guo L, Liu J, Tao
H, Sun W, Chen L, Cong X, Ren S, Shi J, Li J, Wang J, Huang B, Wan
R.
TITLE Highly Efficient Expression of Interleukin-2 under the Control of
Rabbit beta-Globin Intron II Gene Enhances Protective Immune
Responses of Porcine Reproductive and Respiratory Syndrome (PRRS)
DNA Vaccine in Pigs
JOURNAL PLoS ONE 9 (3), E90326 (2014)
PUBMED 24603502
REFERENCE 2 (bases 1 to 3675)
AUTHORS Du Y, Wang X, Huang B, Liu J, Bi J, Wu X, Wu J, Guo L, Chen L, Sun
W, Wang J, Wan R.
TITLE Direct Submission
JOURNAL Submitted (26-SEP-2013) Institute of Animal Science and Veterinary
Medicine, Shandong Academy of Agricultural Sciences, Sangyuan Road
No. 8, Jinan, Shandong 250100, China
REFERENCE 3 (bases 1 to 3675)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 3675)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE";
date: "2014"; volume: "9"; issue: "3"; pages: "E90326"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(26-SEP-2013) Institute of Animal Science and Veterinary Medicine,
Shandong Academy of Agricultural Sciences, Sangyuan Road No. 8,
Jinan, Shandong 250100, China"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3675
/mol_type="other DNA"
/organism="synthetic DNA construct"
enhancer 36..415
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 416..619
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
intron 781..1353
/label=beta-globin intron
/note="intron from rabbit beta-globin gene"
promoter 1408..1426
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
misc_feature 1429..1487
/label=multiple cloning site
/note="multiple cloning site"
polyA_signal 1505..1729
/label=bGH poly(A) signal
/note="bovine growth hormone polyadenylation signal"
CDS 1902..2693
/codon_start=1
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
/translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
rep_origin 3022..3610
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.