pMV361-Edim6 vector (V004391)

MSDS

Basic Vector Information

Vector Name:: pMV361-Edim6

Antibiotic Resistance:: Kanamycin

Length:: 5641 bp

Type:: Shuttle vector

Replication origin:: ori

Source/Author:: Dennehy ME, Bourn W, Steele AD, Williamson A-L.

pMV361-Edim6 vector Vector Map

View Map in NovoBuilder

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pMV361-Edim6 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       V004391                 5641 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004391
VERSION     V004391
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 5641)
  AUTHORS   Dennehy ME, Bourn W, Steele AD, Williamson A-L.
  TITLE     Recombinant BCG expressing rotavirus VP6 partially protects mice
            from rotavirus challenge
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5641)
  AUTHORS   Dennehy ME.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JUN-2005) Medical Virology, University of Cape Town,
            Anzio Road, Observatory, Cape Town 7925, South Africa
REFERENCE   3  (bases 1 to 5641)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5641)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (30-JUN-2005) Medical Virology, University of Cape Town, Anzio Road,
            Observatory, Cape Town 7925, South Africa"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5641
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             120..932
                     /label="KanR"
                     /note="aminoglycoside phosphotransferase"
     rep_origin      1267..1855
                     /direction=RIGHT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             2611..3723
                     /gene="33"
                     /label="Integrase"
                     /note="Integrase from Mycobacterium phage L5. Accession#:
                     P22884"
     regulatory      3899..4291
                     /note="derived from Mycobacterium bovis hsp60 promoter of
                     GenBank Accession Number M17705"
                     /regulatory_class="promoter"
     regulatory      4256..4262
                     /label="derived from Mycobacterium bovis hsp60 RBS"
                     /note="derived from Mycobacterium bovis hsp60 RBS"
                     /regulatory_class="ribosome_binding_site"
     CDS             4274..5503
                     /codon_start=1
                     /product="Hsp60/VP6 chimera"
                     /label="Hsp60/VP6 chimera"
                     /note="first six amino acids of Mycobacterium bovis hsp60
                     linked to 397 amino acids of EDIM rotavirus VP6"
                     /protein_id="AAZ16497.1"
                     /translation="MAKTIADPAAEFMDVLYSISRTLKDARDKIVEGTLYSNVSDLIQQ
                     FNQMLVTMNGNEFQTGGIGNLPLRNWNFDFGLLGTTLLNLDANYVESARTTIDYFVDFI
                     DNVCMDEMMRESQRNGIAPQSDALRKLSGVKFRRINFNNSSEYIENWNLQNRRQRTGFT
                     FHKPNIFPYSASFTLNRSQPQHDNLMGTMWLNAGSEIQVAGFDYSCAINAPANIQQFEH
                     IVQLRRVLTTATITLLPDAERFSFPRVINSADGATTWYFNPVILRPNNVEVEFLLNGQV
                     INTYQARFGTIVARNFDTIRLSFQLMRPPNMTPAVTALFPNAQPFEHHATVGLTLRIDS
                     AICESVLADASETMLANVTSVRQEYAIPVGPVFPPGMNWTDLITNYSPSREDNLQRVFT
                     VASIRSMLVK"
     misc_feature    4274..4291
                     /label="derived from Mycobacterium bovis hsp60 protein"
                     /note="derived from Mycobacterium bovis hsp60 protein"
     misc_feature    4310..5503
                     /note="derived from EDIM rotavirus VP6 (Choi et al., 1997)"
     terminator      5559..5605
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"

This page is informational only.