pMV3319-Edim6 vector (V004393)

MSDS

Basic Vector Information

Vector Name:: pMV3319-Edim6

Antibiotic Resistance:: Kanamycin

Length:: 5625 bp

Type:: Shuttle vector

Replication origin:: ori

Source/Author:: Dennehy ME, Bourn W, Steele AD, Williamson A-L.

pMV3319-Edim6 vector Vector Map

View Map in NovoBuilder

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pMV3319-Edim6 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       V004393                 5625 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004393
VERSION     V004393
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 5625)
  AUTHORS   Dennehy ME, Bourn W, Steele AD, Williamson A-L.
  TITLE     Recombinant BCG expressing rotavirus VP6 partially protects mice
            from rotavirus challenge
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5625)
  AUTHORS   Dennehy ME.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-JUN-2005) Medical Virology, University of Cape Town,
            Anzio Road, Observatory, Cape Town 7925, South Africa
REFERENCE   3  (bases 1 to 5625)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5625)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (27-JUN-2005) Medical Virology, University of Cape Town, Anzio Road,
            Observatory, Cape Town 7925, South Africa"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5625
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             120..932
                     /label="KanR"
                     /note="aminoglycoside phosphotransferase"
     rep_origin      1267..1855
                     /direction=RIGHT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             2611..3723
                     /gene="33"
                     /label="Integrase"
                     /note="Integrase from Mycobacterium phage L5. Accession#:
                     P22884"
     regulatory      3896..4136
                     /note="derived from Mycobacterium bovis hsp60 promoter of
                     GenBank Accession Number M17705"
                     /regulatory_class="promoter"
     CDS             4201..5487
                     /codon_start=1
                     /product="19kDa antigen/VP6 chimera"
                     /label="19kDa antigen/VP6 chimera"
                     /note="21 amino acids of Mycobacterium tuberculosis 19 kDa
                     signal sequence, first 7 amino acids of 19 kDa
                     mature-protein, 3 additional amino acids and 397 amino
                     acids of rotavirus EDIM VP6"
                     /protein_id="AAZ16495.1"
                     /translation="MKRGLTVAVAGAAILVAGLSGCSSNKSTDPKMDVLYSISRTLKDA
                     RDKIVEGTLYSNVSDLIQQFNQMLVTMNGNEFQTGGIGNLPLRNWNFDFGLLGTTLLNL
                     DANYVESARTTIDYFVDFIDNVCMDEMMRESQRNGIAPQSDALRKLSGVKFRRINFNNS
                     SEYIENWNLQNRRQRTGFTFHKPNIFPYSASFTLNRSQPQHDNLMGTMWLNAGSEIQVA
                     GFDYSCAINAPANIQQFEHIVQLRRVLTTATITLLPDAERFSFPRVINSADGATTWYFN
                     PVILRPNNVEVEFLLNGQVINTYQARFGTIVARNFDTIRLSFQLMRPPNMTPAVTALFP
                     NAQPFEHHATVGLTLRIDSAICESVLADASETMLANVTSVRQEYAIPVGPVFPPGMNWT
                     DLITNYSPSREDNLQRVFTVASIRSMLVK"
     misc_feature    4201..4284
                     /note="derived from Mycobacterium tuberculosis 19 kDa
                     protein of GenBank Accession Number J03838"
     sig_peptide     4201..4263
                     /note="derived from Mycobacterium tuberculosis 19 kDa
                     signal peptide"
     misc_feature    4294..5487
                     /note="derived from rotavirus EDIM VP6 of GenBank Accession
                     Number U65988"
     terminator      5543..5589
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"

This page is informational only.