pMU2051 vector (V004407)

LOCUS       V004407                 8975 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004407
VERSION     V004407
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 8975)
  AUTHORS   Zhou J, Olson DG, Argyros DA, Deng Y, van Gulik WM, van Dijken JP,
            Lynd LR.
  TITLE     Atypical Glycolysis in Clostridium thermocellum
  JOURNAL   Appl. Environ. Microbiol. 79 (9), 3000-3008 (2013)
   PUBMED   23435896
REFERENCE   2  (bases 1 to 8975)
  AUTHORS   Argyros A.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-NOV-2012) Thayer School of Engineering, Dartmouth
            College, 14 Engineering Drive, Hanover, NH 03755, USA
REFERENCE   3  (bases 1 to 8975)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8975)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
            Environ. Microbiol."; date: "2013"; volume: "79"; issue: "9"; pages:
            "3000-3008"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (07-NOV-2012) Thayer School of Engineering, Dartmouth College, 14
            Engineering Drive, Hanover, NH 03755, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8975
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(294..1094)
                     /label="URA3"
                     /note="orotidine-5'-phosphate decarboxylase, required for
                     uracil biosynthesis"
     promoter        complement(1095..1315)
                     /label="URA3 promoter"
     misc_feature    1343..1846
                     /label="CEN/ARS"
                     /note="S. cerevisiae CEN6 centromere fused to an
                     autonomously replicating sequence"
     misc_feature    1888..2407
                     /label="similar to pyruvate phosphate dikinase"
                     /note="similar to pyruvate phosphate dikinase"
     misc_feature    2408..2929
                     /label="similar to pyruvate phosphate dikinase"
                     /note="similar to pyruvate phosphate dikinase"
     regulatory      complement(2932..3063)
                     /label="hpt terminator"
                     /note="hpt terminator"
                     /regulatory_class="terminator"
     CDS             complement(3064..3618)
                     /codon_start=1
                     /product="hypoxanthine phosporibosyl transferase"
                     /label="hypoxanthine phosporibosyl transferase"
                     /protein_id="AGE45855.1"
                     /translation="MINQIKEILVTREELKNNAKELGKRISSDYEGKELVLIGVLKGGV
                     VFFADLIREITIPIDVDFISVSSYGNSTKSSGVVRIIKDIDIDITNKHVLIVEDLVDTG
                     LTLHYLKSMFEARGPKDVKICTALDKPSRRKVDLEIDYKGITIPDKFVVGYGLDYAEKY
                     RNLPDVCVLDSSVYTDKEDMD"
     CDS             complement(3637..4284)
                     /gene="cat"
                     /label="Chloramphenicol acetyltransferase"
                     /note="Chloramphenicol acetyltransferase from
                     Staphylococcus aureus. Accession#: P00485"
     regulatory      complement(4265..4812)
                     /label="glyceraldehyde 3-phosphate dehydrogenase promoter"
                     /note="glyceraldehyde 3-phosphate dehydrogenase promoter"
                     /regulatory_class="promoter"
     misc_feature    4813..5361
                     /label="similar to pyruvate phosphate dikinase"
                     /note="similar to pyruvate phosphate dikinase"
     CDS             complement(5362..5940)
                     /codon_start=1
                     /product="thymidine kinase"
                     /label="thymidine kinase"
                     /protein_id="AGE45857.1"
                     /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA
                     IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI
                     ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP
                     ANYDDPIIMVGAKESYEARCRKCHEVPRT"
     regulatory      complement(5941..6561)
                     /label="cbp promoter"
                     /note="cbp promoter"
                     /regulatory_class="promoter"
     CDS             complement(6671..7672)
                     /label="repB"
                     /note="RepB replication protein"
     rep_origin      complement(7673..8133)
                     /direction=LEFT
                     /label="Clostridium thermocellum replication origin"
                     /note="Clostridium thermocellum replication origin"
     rep_origin      complement(8364..8952)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"