pMU2051 vector (V004407)

MSDS

Basic Vector Information

Vector Name:: pMU2051

Antibiotic Resistance:: Chloramphenicol

Length:: 8975 bp

Type:: Cloning vector

Replication origin:: ori

Host:: Yeast

Source/Author:: Zhou J, Olson DG, Argyros DA, Deng Y, van Gulik WM, van Dijken JP, Lynd LR.

Promoter:: URA3

pMU2051 vector Vector Map

View Map in NovoBuilder

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pMU2051 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       V004407                 8975 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004407
VERSION     V004407
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 8975)
  AUTHORS   Zhou J, Olson DG, Argyros DA, Deng Y, van Gulik WM, van Dijken JP,
            Lynd LR.
  TITLE     Atypical Glycolysis in Clostridium thermocellum
  JOURNAL   Appl. Environ. Microbiol. 79 (9), 3000-3008 (2013)
   PUBMED   23435896
REFERENCE   2  (bases 1 to 8975)
  AUTHORS   Argyros A.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-NOV-2012) Thayer School of Engineering, Dartmouth
            College, 14 Engineering Drive, Hanover, NH 03755, USA
REFERENCE   3  (bases 1 to 8975)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8975)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
            Environ. Microbiol."; date: "2013"; volume: "79"; issue: "9"; pages:
            "3000-3008"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (07-NOV-2012) Thayer School of Engineering, Dartmouth College, 14
            Engineering Drive, Hanover, NH 03755, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8975
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(294..1094)
                     /label="URA3"
                     /note="orotidine-5'-phosphate decarboxylase, required for
                     uracil biosynthesis"
     promoter        complement(1095..1315)
                     /label="URA3 promoter"
     misc_feature    1343..1846
                     /label="CEN/ARS"
                     /note="S. cerevisiae CEN6 centromere fused to an
                     autonomously replicating sequence"
     misc_feature    1888..2407
                     /label="similar to pyruvate phosphate dikinase"
                     /note="similar to pyruvate phosphate dikinase"
     misc_feature    2408..2929
                     /label="similar to pyruvate phosphate dikinase"
                     /note="similar to pyruvate phosphate dikinase"
     regulatory      complement(2932..3063)
                     /label="hpt terminator"
                     /note="hpt terminator"
                     /regulatory_class="terminator"
     CDS             complement(3064..3618)
                     /codon_start=1
                     /product="hypoxanthine phosporibosyl transferase"
                     /label="hypoxanthine phosporibosyl transferase"
                     /protein_id="AGE45855.1"
                     /translation="MINQIKEILVTREELKNNAKELGKRISSDYEGKELVLIGVLKGGV
                     VFFADLIREITIPIDVDFISVSSYGNSTKSSGVVRIIKDIDIDITNKHVLIVEDLVDTG
                     LTLHYLKSMFEARGPKDVKICTALDKPSRRKVDLEIDYKGITIPDKFVVGYGLDYAEKY
                     RNLPDVCVLDSSVYTDKEDMD"
     CDS             complement(3637..4284)
                     /gene="cat"
                     /label="Chloramphenicol acetyltransferase"
                     /note="Chloramphenicol acetyltransferase from
                     Staphylococcus aureus. Accession#: P00485"
     regulatory      complement(4265..4812)
                     /label="glyceraldehyde 3-phosphate dehydrogenase promoter"
                     /note="glyceraldehyde 3-phosphate dehydrogenase promoter"
                     /regulatory_class="promoter"
     misc_feature    4813..5361
                     /label="similar to pyruvate phosphate dikinase"
                     /note="similar to pyruvate phosphate dikinase"
     CDS             complement(5362..5940)
                     /codon_start=1
                     /product="thymidine kinase"
                     /label="thymidine kinase"
                     /protein_id="AGE45857.1"
                     /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA
                     IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI
                     ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP
                     ANYDDPIIMVGAKESYEARCRKCHEVPRT"
     regulatory      complement(5941..6561)
                     /label="cbp promoter"
                     /note="cbp promoter"
                     /regulatory_class="promoter"
     CDS             complement(6671..7672)
                     /label="repB"
                     /note="RepB replication protein"
     rep_origin      complement(7673..8133)
                     /direction=LEFT
                     /label="Clostridium thermocellum replication origin"
                     /note="Clostridium thermocellum replication origin"
     rep_origin      complement(8364..8952)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"

This page is informational only.