Basic Vector Information
- Vector Name:
- pMSW107
- Antibiotic Resistance:
- Kanamycin
- Length:
- 10933 bp
- Type:
- Cloning vector
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Wecker MS, Beaton S, Chado R, Ghirardi ML.
- Promoter:
- T3
pMSW107 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMSW107 vector Sequence
LOCUS 40924_32425 10933 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pMSW107, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10933) AUTHORS Wecker MS, Beaton S, Chado R, Ghirardi ML. TITLE Development of a Rhodobacter capsulatus self-reporting model system for optimizing light-dependent, [FeFe]-hydrogenase-driven H production JOURNAL Biotechnol. Bioeng. (2016) In press PUBMED 27531314 REFERENCE 2 (bases 1 to 10933) AUTHORS Wecker MS. TITLE Direct Submission JOURNAL Submitted (26-MAY-2016) Molecular Biology, GeneBiologics, 1047 Cherryvale Road, Boulder, CO 80303, USA REFERENCE 3 (bases 1 to 10933) TITLE Direct Submission REFERENCE 4 (bases 1 to 10933) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol. Bioeng. (2016) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (26-MAY-2016) Molecular Biology, GeneBiologics, 1047 Cherryvale Road, Boulder, CO 80303, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10933 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 458..1249 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" protein_bind 1657..1678 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 1693..1723 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 1731..1747 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 1755..1771 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 1792..1810 /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" CDS complement(1832..2548) /label=EmGFP /note="Emerald GFP" misc_feature complement(2549..2770) /gene="HupSL-emGFP" /note="HupSL remnant; acts as signal sequence for the downstream emGFP" regulatory complement(2771..3299) /regulatory_class="promoter" primer_bind 3306..3322 /label=KS primer /note="common sequencing primer, one of multiple similar variants" primer_bind complement(3356..3372) /label=SK primer /note="common sequencing primer, one of multiple similar variants" promoter complement(3405..3423) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(3433..3449) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" regulatory 3881..4491 /note="fru promoter; derived from Rhodobacter capsulatus" /regulatory_class="promoter" CDS 4492..5544 /codon_start=1 /gene="hydE" /product="HydE" /label=hydE /note="derived from Clostridium acetobutylicum strain DSM 1731; codon-optimized for Rhodobacter capsulatus" /protein_id="AOF40442.1" /translation="MDNIIKLINKAEVTHDLTKDELVTLLKDDTHNEEIYKAADRVREK YVGEEVHLRGLIEFSNICKRNCMYCGLRRDNKNIKRYRLEPDEIIHLAKSAKNYGYQTV VLQSGEDDYYTVEKMKYIVSEIKKLNMAITLSIGEKTFEEYEEYRKSGADRYLIRIETT DKELYEKLDPKMSHENRINCLKNLRKLGYEVGSGCLVGLPNQTIESLADDILFFKEIDA DMIGVGPFIPNEDTPLGEEKGGEFFMSVKVTALIRLLLPDINIPATTAMESLYPNGRSI ALTSGANVVMPNVTEGEYRKLYALYPGKICVNDTPGHCRQCISLKINKINRKVSATKGF RKKSYKESIG" gene 4492..5544 /gene="hydE" /label=hydE CDS 5558..6793 /codon_start=1 /gene="hydF" /product="HydF" /label=hydF /note="derived from Clostridium acetobutylicum strain DSM 1731; codon-optimized for Rhodobacter capsulatus" /protein_id="AOF40443.1" /translation="MNELNSTPKGERLHIALFGKTNVGKSSVINALTSQEIALVSNVKG TTTDPVYKAMELLPLGPVMLIDTAGLDDISDLGELRRGKTLEVLSKTDVAILVFDVESG ITEYDKNIYSLLLEKKIPLIGVLNKIDKKDYKLEDYTSQFKIPIVPISALNNKGINNLK DELIRLAPENDDKFKIVGDLLSPGDIAVLVTPIDKAAPKGRLILPQQQTIRDILESDAI AMVTKEFELRETLDSLRKKPKIVITDSQVFLKVAADTPKDILMTSFSILMARHKGDLIE LARGARAIEDLKDGDKILIAEACTHHRQSDDIGKVKIPRWLRQKTGKKLEFDFSSGFSF PPNIEDYALIVHCAGCMLNRRSMLHRIESSVKKQIPIVNYGVLIAYVQGILPRALKPFP YADRIFNQSSRN" gene 5558..6793 /gene="hydF" /label=hydF CDS 6807..8225 /codon_start=1 /gene="hydG" /product="HydG" /label=hydG /note="derived from Clostridium acetobutylicum strain DSM 1731; codon-optimized for Rhodobacter capsulatus" /protein_id="AOF40444.1" /translation="MYNVKSKVATEFISDEEIIDSLEYAKQNKSNRELIDSIIEKAKEC KGLTHRDAAVLLECDLEDENEKMFKLAREIKQKFYGNRIVMFAPLYLSNYCVNGCVYCP YHHKNKHIARKKLSQEDVKRETIALQDMGHKRLALEAGEDPVNNPIEYILDCIKTIYSI KHKNGAIRRVNVNIAATTVENYKKLKDAGIGTYILFQETYNKKSYEELHPTGPKHDYAY HTEAMDRAMEGGIDDVGIGVLFGLNMYKYDFVGLLMHAEHLEAAMGVGPHTISVPRIRP ADDIDPENFSNAISDEIFEKIVAIIRIAVPYTGMIVSTRESKKTRERVLELGISQISGG SSTSVGGYVESEPEEDNSSQFEVNDNRTLDEIVNWLLEMNYIPSFCTACYREGRTGDRF MSLVKSGQIANCCQPNALMTLKEYLEDYASSNTQKNGEALIASEVEKIPNEKVKSIVKK HLTELKEGQRDFRF" gene 6807..8225 /gene="hydG" /label=hydG CDS complement(8482..9141) /label=pBBR1 Rep /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica" rep_origin complement(9142..9911) /direction=LEFT /label=pBBR1 oriV /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication"
This page is informational only.