Basic Vector Information
- Vector Name:
- pRS002
- Antibiotic Resistance:
- Streptomycin
- Length:
- 4265 bp
- Type:
- Cloning vector
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Ghosh IN, Landick R.
pRS002 vector Map
pRS002 vector Sequence
LOCUS 40924_37728 4265 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pRS002, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4265)
AUTHORS Ghosh IN, Landick R.
TITLE OptSSeq: High-throughput sequencing readout of growth enrichment
defines optimal gene expression elements for homoethanologenesis
JOURNAL ACS Synth Biol (2016) In press
PUBMED 27404024
REFERENCE 2 (bases 1 to 4265)
AUTHORS Ghosh IN, Landick RC.
TITLE Direct Submission
JOURNAL Submitted (15-JUL-2016) DOE Great Lakes Bioenergy Research Center,
University of Wisconsin-Madison, 1552 University Avenue, Madison, WI
53726, United States
REFERENCE 3 (bases 1 to 4265)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4265)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "ACS Synth
Biol (2016) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(15-JUL-2016) DOE Great Lakes Bioenergy Research Center, University
of Wisconsin-Madison, 1552 University Avenue, Madison, WI 53726,
United States"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4265
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 1903..1994
/label=AmpR promoter
CDS 1995..2783
/codon_start=1
/label=SmR
/note="aminoglycoside adenylyltransferase (Murphy, 1985)"
/translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"
CDS complement(3361..4020)
/codon_start=1
/label=pBBR1 Rep
/note="replication protein for the broad-host-range plasmid
pBBR1 from Bordetella bronchiseptica"
/translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH
HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV
NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE
PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR"
rep_origin complement(join(4021..4265,1..525))
/direction=LEFT
/label=pBBR1 oriV
/note="replication origin of the broad-host-range plasmid
pBBR1 from Bordetella bronchiseptica; requires the pBBR1
Rep protein for replication"
This page is informational only.