pRL692 vector (V003710)

LOCUS       V003710                 7738 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V003710
VERSION     V003710
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 7738)
  AUTHORS   Koksharova OA, Wolk CP.
  TITLE     A novel gene that bears a DnaJ motif influences cyanobacterial cell
            division
  JOURNAL   J. Bacteriol. 184 (19), 5524-5528 (2002)
   PUBMED   12218043
REFERENCE   2  (bases 1 to 7738)
  AUTHORS   Wolk CP.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-SEP-2001) MSU-DOE Plant Research Laboratory, Michigan
            State University, Wilson Road, E. Lansing, MI 48824, USA
REFERENCE   3  (bases 1 to 7738)
  AUTHORS   Wolk CP.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-MAR-2012) MSU-DOE Plant Research Laboratory, Michigan
            State University, Wilson Road, E. Lansing, MI 48824, USA
REFERENCE   4  (bases 1 to 7738)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 7738)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J.
            Bacteriol."; date: "2002"; volume: "184"; issue: "19"; pages:
            "5524-5528"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (26-SEP-2001) MSU-DOE Plant Research Laboratory, Michigan State
            University, Wilson Road, E. Lansing, MI 48824, USA"
            SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
            (01-MAR-2012) MSU-DOE Plant Research Laboratory, Michigan State
            University, Wilson Road, E. Lansing, MI 48824, USA"
            SGRef: number: 4; type: "Journal Article"
            On Mar 1, 2012 this sequence version replaced AF424805.1.
            Transposon-bearing plasmid pRL692, a derivative of pRL1063a (GenBank
            Accession Number U55385), bearing transposon Tn5-692 containing the
            erm gene from pE194 (GenBank Accession Number J01755) and,
            downstream from the promoter of ribulose bisphosphate carboxylase
            from Synechococcus sp. PCC 6301 (GenBank Accession Number X03220),
            the aadA region from Tn7 (GenBank Accession Number X03043).  The
            transposon confers resistance to erythromycin, streptomycin and
            spectinomycin.  The transposase gene has been altered by
            substitution of a 208-bp Psp1406I fragment with an equal-sized
            fragment from pRZ5421 (Zhou, M., A. Bhasin, and W.S. Reznikoff, J.
            Mol. Biol. 276:913-925, 1998).  The inverted repeats are modeled on
            those of pRZ5421.  In addition, a SpeI site has been inserted
            between the promoter of the transposase and the nearby terminal
            inverted repeat of the transposon.
            Transposon Tn5-692 borne by pRL692 efficiently mutagenizes
            Synechococcus sp. strain PCC 7942 and Anabaena variabilis strain
            ATCC 29413.  The user is cautioned that this transposon appears able
            to transpose repeatedly.
FEATURES             Location/Qualifiers
     source          1..7738
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    1..19
                     /label="Tn5 ME"
                     /note="hyperactive mosaic end for Tn5 transposase
                     recognition (Reznikoff et al., 2004)"
     CDS             409..1197
                     /codon_start=1
                     /gene="aadA"
                     /product="3'(9)-O-nucleotidyltransferase"
                     /label="aadA"
                     /note="streptomycin adenylyltransferase; from Tn7"
                     /protein_id="AAL30370.1"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
     gene            409..1197
                     /gene="aadA"
                     /label="aadA"
     rep_origin      2639..3227
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(3481..4212)
                     /gene="ermC"
                     /label="rRNA adenine N-6-methyltransferase"
                     /note="rRNA adenine N-6-methyltransferase from
                     Staphylococcus aureus. Accession#: P02979"
     promoter        4485..4587
                     /label="cat promoter"
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             complement(5350..6777)
                     /label="Tn5 transposase"
                     /note="transposase from the bacterial Tn5 transposon
                     (Reznikoff, 1993)"
     misc_feature    complement(6852..6870)
                     /label="Tn5 ME"
                     /note="hyperactive mosaic end for Tn5 transposase
                     recognition (Reznikoff et al., 2004)"
     CDS             complement(7056..7424)
                     /label="traJ"
                     /note="oriT-recognizing protein"
     oriT            complement(7457..7566)
                     /direction=LEFT
                     /label="oriT"
                     /note="incP origin of transfer"