pRI857-BAC vector (V003736)

LOCUS       40924_37068        8808 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pRI857-BAC, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8808)
  AUTHORS   Zhang K, Su H, Yang M, Ge J, Li G, Yi J, Wang Y.
  TITLE     Construction of a thermo-sensitive pRI857 vector for efficient DNA 
            capturing in Escherichia coli
  JOURNAL   Biotechnol. Lett. (2017) In press
  PUBMED    28251389
REFERENCE   2  (bases 1 to 8808)
  AUTHORS   Zhang K, Wang Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-AUG-2016) College of Environmental and Biological 
            Engineering, Nanjing University of Science and Technology, 200 
            Xiaolingwei, Nanjing, Jiangsu 210094, China
REFERENCE   3  (bases 1 to 8808)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8808)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol.
            Lett. (2017) In press"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (24-AUG-2016) College of Environmental and Biological Engineering, 
            Nanjing University of Science and Technology, 200 Xiaolingwei, 
            Nanjing, Jiangsu 210094, China"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..8808
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(4..795)
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     RBS             799..807
                     /label=Shine-Dalgarno sequence
                     /note="full consensus sequence for ribosome-binding sites 
                     upstream of start codons in E. coli; complementary to a 
                     region in the 3' end of the 16S rRNA (Chen et al., 1994)"
     protein_bind    950..971
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        986..1016
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    1024..1040
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     CDS             1060..1770
                     /label=lambda repressor (ts)
                     /note="temperature-sensitive variant of the phage lambda
                     repressor"
     regulatory      2026..2062
                     /regulatory_class="terminator"
     CDS             complement(2129..2761)
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
     promoter        complement(2762..2864)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             2980..3327
                     /codon_start=1
                     /gene="redF"
                     /product="RedF"
                     /label=redF
                     /protein_id="AQX17847.1"
                     /translation="MERRNRRTGRTEKARIWEVTDRTVRTWIGEAVAAAAADGVTFSVP
                     VTPHTFRHSYAMHMLYAGIPLKVLQSLMGHKSISSTEVYTKVFALDVAARHRVQFAMPE
                     SDAVAMLKQLS"
     gene            2980..3327
                     /gene="redF"
                     /label=redF
     rep_origin      3723..4337
                     /label=oriV
                     /note="origin of replication for the bacterial F plasmid"
     rep_origin      4413..4632
                     /label=ori2
                     /note="secondary origin of replication for the bacterial F 
                     plasmid; also known as oriS"
     CDS             4723..5475
                     /label=repE
                     /note="replication initiation protein for the bacterial F 
                     plasmid"
     misc_feature    5481..5731
                     /label=incC
                     /note="incompatibility region of the bacterial F plasmid"
     CDS             6057..7229
                     /label=sopA
                     /note="partitioning protein for the bacterial F plasmid"
     CDS             7232..8200
                     /label=sopB
                     /note="partitioning protein for the bacterial F plasmid"
     misc_feature    8276..8749
                     /label=sopC
                     /note="centromere-like partitioning region of the bacterial
                     F plasmid"