Cart 2

PRFP vector (V003748#)

Basic Vector Information

Basic Vector Information
Vector Name PRFP Antibiotic Resistance Ampicillin
Length 3469 bp Type Cloning vector
Source Zhang J.

PRFP vector Vector Map

lacZ-alpha lac operator lac promoter CAP binding site ori AmpR AmpR promoter

PRFP vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                3469 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector PRFP, complete sequence.
ACCESSION   KX755250
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3469)
  AUTHORS   Zhang J.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-AUG-2016) Research Institute of Pomology, Chinese 
            Academy of Agricultural Sciences, Xingcheng, Liaoning 125100, China
REFERENCE   2  (bases 1 to 3469)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..3469
                     /organism="Cloning vector PRFP"
                     /mol_type="other DNA"
                     /db_xref="taxon:2024710"
     CDS             complement(146..1252)
                     /codon_start=1
                     /gene="lacZ fragment"
                     /product="LacZ-alpha fragment of beta-galactosidase"
                     /label=lacZ-alpha
                     /translation="MTMITPSLHACRSTLDSRDPDLQSSLVPQFAREVAVSGHSHLVLL
                     DVGLFVGLLDSFQSVVHIVDAGHLEVLSGFLGSVCGLEVADQVAPAHELQGHVASAFQA
                     AVSGVQHLGVGLPAECFLLHHRAVGWEVHPSDLDVVDEAAVLEAGVLGSGQHAPVFVCG
                     DSLPCEALREGLLKEVGDALGVVDEGSAAVHEAGSQDVEGEGERAALDHLDSHGLGALV
                     GLAFALGCALEVVVVHGALHVQLHVHVLLNQLAHRPGLQAAAHGISSIICRPIVSRITV
                     PSSNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL
                     MRYFLLTHLCGISHRIWCTLSTICSDAA"
     primer_bind     379..395
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        415..433
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     CDS             485..1180
                     /codon_start=1
                     /product="red fluorescence protein"
                     /label=red fluorescence protein
                     /protein_id="ASR91725.1"
                     /translation="MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKV
                     VEGGPLPFAFDILATSFMYGSRTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTA
                     TQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEANTEMLYPADGGLEGRSDMALK
                     LVGGGHLICNFKTTYRSKKPAKNLKMPGVYYVDHRLERIKEADKETYVEQHEVAVARYC
                     DLPSKLGHK"
     primer_bind     complement(1248..1264)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    1272..1288
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(1296..1326)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    1341..1362
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     rep_origin      complement(1650..2238)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(2409..3269)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /label=AmpR
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQAQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFLADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAAIGAS
                     LIKHW"
     promoter        complement(3270..3374)
                     /gene="bla"
                     /label=AmpR promoter

This page is informational only.