Basic Vector Information
- Vector Name:
- PRFP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3469 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Zhang J.
PRFP vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
PRFP vector Sequence
LOCUS 40924_36923 3469 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector PRFP, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3469) AUTHORS Zhang J. TITLE Direct Submission JOURNAL Submitted (17-AUG-2016) Research Institute of Pomology, Chinese Academy of Agricultural Sciences, Xingcheng, Liaoning 125100, China REFERENCE 2 (bases 1 to 3469) TITLE Direct Submission REFERENCE 3 (bases 1 to 3469) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (17-AUG-2016) Research Institute of Pomology, Chinese Academy of Agricultural Sciences, Xingcheng, Liaoning 125100, China" COMMENT SGRef: number: 2; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..3469 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 415..433 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 491..1177 /codon_start=1 /label=TagRFP /note="monomeric derivative of red fluorescent protein from Entacmaea quadricolor (Merzlyak et al., 2007)" /translation="ELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVE GGPLPFAFDILATSFMYGSRTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQ DTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEANTEMLYPADGGLEGRSDMALKLV GGGHLICNFKTTYRSKKPAKNLKMPGVYYVDHRLERIKEADKETYVEQHEVAVARYCDL PSKLGHK" primer_bind complement(1248..1264) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(1272..1288) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(1296..1326) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(1341..1362) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(1650..2238) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2412..3269) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQAQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFLADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAAIGAS LIKHW" promoter complement(3270..3374) /label=AmpR promoter
This page is informational only.