PRFP vector (V003748)

Basic Vector Information

      • Vector Name:
      • PRFP
      • Antibiotic Resistance:
      • Ampicillin
      • Length:
      • 3469 bp
      • Type:
      • Cloning vector
      • Source/Author:
      • Zhang J.

PRFP vector Vector Map

PRFP3469 bp6001200180024003000lacZ-alphalac operatorlac promoterCAP binding siteoriAmpRAmpR promoter

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

PRFP vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                3469 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector PRFP, complete sequence.
ACCESSION   KX755250
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3469)
  AUTHORS   Zhang J.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-AUG-2016) Research Institute of Pomology, Chinese 
            Academy of Agricultural Sciences, Xingcheng, Liaoning 125100, China
REFERENCE   2  (bases 1 to 3469)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..3469
                     /organism="Cloning vector PRFP"
                     /mol_type="other DNA"
                     /db_xref="taxon:2024710"
     CDS             complement(146..1252)
                     /codon_start=1
                     /gene="lacZ fragment"
                     /product="LacZ-alpha fragment of beta-galactosidase"
                     /label=lacZ-alpha
                     /translation="MTMITPSLHACRSTLDSRDPDLQSSLVPQFAREVAVSGHSHLVLL
                     DVGLFVGLLDSFQSVVHIVDAGHLEVLSGFLGSVCGLEVADQVAPAHELQGHVASAFQA
                     AVSGVQHLGVGLPAECFLLHHRAVGWEVHPSDLDVVDEAAVLEAGVLGSGQHAPVFVCG
                     DSLPCEALREGLLKEVGDALGVVDEGSAAVHEAGSQDVEGEGERAALDHLDSHGLGALV
                     GLAFALGCALEVVVVHGALHVQLHVHVLLNQLAHRPGLQAAAHGISSIICRPIVSRITV
                     PSSNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL
                     MRYFLLTHLCGISHRIWCTLSTICSDAA"
     primer_bind     379..395
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        415..433
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     CDS             485..1180
                     /codon_start=1
                     /product="red fluorescence protein"
                     /label=red fluorescence protein
                     /protein_id="ASR91725.1"
                     /translation="MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKV
                     VEGGPLPFAFDILATSFMYGSRTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTA
                     TQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEANTEMLYPADGGLEGRSDMALK
                     LVGGGHLICNFKTTYRSKKPAKNLKMPGVYYVDHRLERIKEADKETYVEQHEVAVARYC
                     DLPSKLGHK"
     primer_bind     complement(1248..1264)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    1272..1288
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(1296..1326)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    1341..1362
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     rep_origin      complement(1650..2238)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(2409..3269)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /label=AmpR
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQAQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFLADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAAIGAS
                     LIKHW"
     promoter        complement(3270..3374)
                     /gene="bla"
                     /label=AmpR promoter

This page is informational only.