pPV529 vector (V003895)

LOCUS       40924_35683        6638 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pPV529, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6638)
  AUTHORS   Shao H, Li X, Lok JB.
  TITLE     Heritable genetic transformation of Strongyloides stercoralis by 
            microinjection of plasmid DNA constructs into the male germline
  JOURNAL   Int. J. Parasitol. (2017) In press
  PUBMED    28577882
REFERENCE   2  (bases 1 to 6638)
  AUTHORS   Shao H, Li X, Lok JB.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-MAR-2017) Pathobiology, University of Pennsylvania, 
            3800 Spruce Street, Rosenthal 212, Philadelphia, PA 19104, USA
REFERENCE   3  (bases 1 to 6638)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6638)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Int. J. 
            Parasitol. (2017) In press"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (28-MAR-2017) Pathobiology, University of Pennsylvania, 3800 Spruce 
            Street, Rosenthal 212, Philadelphia, PA 19104, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..6638
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        27..131
                     /label=AmpR promoter
     CDS             132..989
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      1163..1751
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     protein_bind    2039..2060
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        2075..2105
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    2113..2129
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     2137..2153
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     mobile_element  2644..2678
                     /mobile_element_type="transposon:PiggyBac ITR"
                     /label=ITR
     regulatory      2954..4116
                     /regulatory_class="promoter"
     CDS             join(4129..4299,4351..4504,4556..4719,4771..4998)
                     /codon_start=1
                     /gene="gfp"
                     /product="green fluorescent protein"
                     /label=gfp
                     /note="GFP"
                     /protein_id="ARW80044.1"
                     /translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK
                     FICTTGKLPVPWPTLVTTFCYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDG
                     NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV
                     NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE
                     FVTAAGITHGMDELYK"
     gene            4129..4998
                     /gene="gfp"
                     /label=gfp
     3'UTR           5018..5604
                     /gene="Ss era-1"
     gene            5018..5604
                     /gene="Ss era-1"
                     /label=Ss era-1
     primer_bind     5618..5634
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     mobile_element  5831..5893
                     /mobile_element_type="transposon:PiggyBac ITR"
                     /label=ITR
     primer_bind     complement(6023..6039)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     rep_origin      6181..6636
                     /direction=RIGHT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"