Basic Vector Information
- Vector Name:
- pPIPRA728
- Antibiotic Resistance:
- Kanamycin
- Length:
- 10559 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Figueroa-Balderas RE, Chi-Ham CL, Le H, Tricoli D, Sandman J, Johnson D, Reich J, Bennett AB.
- Promoter:
- MAS
pPIPRA728 vector Map
pPIPRA728 vector Sequence
LOCUS 40924_34719 10559 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pPIPRA728, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 10559)
AUTHORS Figueroa-Balderas RE, Chi-Ham CL, Le H, Tricoli D, Sandman J,
Johnson D, Reich J, Bennett AB.
TITLE Constitutive expression of eIF5A3 increases high quality biomass
yield in an elite alfalfa cultivar
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 10559)
AUTHORS Figueroa-Balderas RE, Chi-Ham CL, Le H, Tricoli D, Sandman J,
Johnson D, Reich J, Bennett AB.
TITLE Direct Submission
JOURNAL Submitted (13-JAN-2015) Plant Sciences, UC Davis, One shields
Avenue, Davis, CA 95616, USA
REFERENCE 3 (bases 1 to 10559)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 10559)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(13-JAN-2015) Plant Sciences, UC Davis, One shields Avenue, Davis,
CA 95616, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..10559
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 245..269
/label=LB T-DNA repeat
/note="left border repeat from nopaline C58 T-DNA"
promoter 362..742
/label=MAS promoter
/note="mannopine synthase promoter (Velten et al., 1984)"
CDS 762..1550
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
terminator 1571..1823
/label=MAS terminator
/note="mannopine synthase terminator"
regulatory 1880..2823
/label=FMV34S
/note="FMV34S"
/regulatory_class="promoter"
CDS 2875..3354
/codon_start=1
/gene="eIF5A3"
/product="eukaryotic translation initiation factor 5A"
/label=eIF5A3
/note="eIF5A3; derived from Populus deltoides"
/protein_id="AKE42819.1"
/translation="MSDEEQHFESKADAGASKTYPQQAGTIRKSGYIVIKNRPCKVVEV
STSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSL
LTENGNTKDDLRLPTDESLLSQIKDGFGEGKDLVVTVMSSMGEEQICALKDVGPK"
gene 2875..3354
/gene="eIF5A3"
/label=eIF5A3
/note="PdeIF5A3"
regulatory 3377..3680
/label=pea E9
/note="pea E9"
/regulatory_class="terminator"
misc_feature 3767..3791
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
CDS 5243..5869
/label=pVS1 StaA
/note="stability protein from the Pseudomonas plasmid pVS1
(Heeb et al., 2000)"
CDS 6301..7371
/label=pVS1 RepA
/note="replication protein from the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
rep_origin 7440..7634
/label=pVS1 oriV
/note="origin of replication for the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
misc_feature 8108..8248
/label=bom
/note="basis of mobility region from pBR322"
rep_origin complement(8434..9022)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(9490..10281)
/label=KanR
/note="aminoglycoside phosphotransferase"
This page is informational only.