pPIPRA713 vector (V004086)

LOCUS       40924_34699       10675 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pPIPRA713, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10675)
  AUTHORS   Figueroa-Balderas RE, Chi-Ham CL, Le H, Tricoli D, Sandman J, 
            Johnson D, Reich J, Bennett AB.
  TITLE     Constitutive expression of eIF5A3 increases high quality biomass 
            yield in an elite alfalfa cultivar
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10675)
  AUTHORS   Figueroa-Balderas RE, Chi-Ham CL, Le H, Tricoli D, Sandman J, 
            Johnson D, Reich J, Bennett AB.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JAN-2015) Plant Sciences, UC Davis, One shields 
            Avenue, Davis, CA 95616, USA
REFERENCE   3  (bases 1 to 10675)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 10675)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (13-JAN-2015) Plant Sciences, UC Davis, One shields Avenue, Davis, 
            CA 95616, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10675
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        26..406
                     /label=MAS promoter
                     /note="mannopine synthase promoter (Velten et al., 1984)"
     CDS             420..1142
                     /codon_start=1
                     /gene="ipt"
                     /product="isopentenyl phosphotransferase"
                     /label=ipt
                     /note="involved in condensation of AMP and 
                     isopentenylpyrophosphate to form isopentenyl-AMP"
                     /protein_id="AKE42821.1"
                     /translation="MDLHLIFGPTCTGKTTTAIALAQQTGLPVLSLDRVQCCPQLSTGS
                     GRPTVEELKGTTRLYLDDRPLVEGIIAAKQAHHRLIEEVYNHEANGGLILEGGSTSLLN
                     CMARNSYWSADFRWHIIRHKLPDQETFMKAAKARVKQMLHPAAGHSIIQELVYLWNEPR
                     LRPILKEIDGYRYAMLFASQNQITADMLLQLDANMEGKLINGIAQEYFIHARQQEQKFP
                     QVNAAAFDGFEGHPFGMY"
     gene            420..1142
                     /gene="ipt"
                     /label=ipt
     terminator      1505..1757
                     /label=MAS terminator
                     /note="mannopine synthase terminator"
     misc_feature    1782..1949
                     /label=T-DNA left border
                     /note="T-DNA left border"
     regulatory      1981..2924
                     /label=FMV34S
                     /note="FMV34S"
                     /regulatory_class="promoter"
     CDS             2976..3455
                     /codon_start=1
                     /gene="eIF5A3"
                     /product="eukaryotic translation initiation factor 5A"
                     /label=eIF5A3
                     /note="eIF5A3; derived from Populus deltoides"
                     /protein_id="AKE42822.1"
                     /translation="MSDEEQHFESKADAGASKTYPQQAGTIRKSGYIVIKNRPCKVVEV
                     STSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSL
                     LTENGNTKDDLRLPTDESLLSQIKDGFGEGKDLVVTVMSSMGEEQICALKDVGPK"
     gene            2976..3455
                     /gene="eIF5A3"
                     /label=eIF5A3
                     /note="PdeIF5A3"
     regulatory      3478..3781
                     /label=pea E9
                     /note="pea E9"
                     /regulatory_class="terminator"
     misc_feature    3812..4020
                     /label=T-DNA left border
                     /note="T-DNA left border"
     CDS             5359..5985
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"
     CDS             6417..7487
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     rep_origin      7556..7750
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     misc_feature    8224..8364
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(8550..9138)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(9606..10397)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"